KEGG   Listeria seeligeri: lse_2616Help
Entry
lse_2616          CDS       T01184                                 

Gene name
recR
Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
lsg  Listeria seeligeri
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lsg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    lse_2616 (recR)
DNA repair and recombination proteins [BR:lsg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      lse_2616 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2686634..2687230)
Genome map
AA seq 198 aa AA seqDB search
MHYPEPITKLMDSFMKLPGIGPKSAARLAFYVLDMKEDDVLDFAKALVDAKRNLSFCSVC
GHITDKDPCYICVDTSRDRSIICVVQESKDVIAMEKMRDFHGLYHVLHGTISPMDGIGPE
DINIPDLLKRLQDDTIEEVILATNPNVEGEATAMYISRLLKPSGIKITRIAHGLPVGGDL
EYADEVTLSKAMEGRREV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatcctgagccgataacgaaattaatggacagttttatgaaattaccgggtatc
ggacccaaatcggcagcgagactcgcattttatgtgcttgatatgaaagaagacgatgtg
ttagactttgcaaaagcgctagttgatgcaaaacgtaacttgagcttttgttctgtttgt
ggacatattactgataaagatccttgctacatttgcgtagacacttctcgtgaccgcagc
attatttgtgtagtacaagaatcaaaagatgttatcgctatggaaaaaatgcgtgatttt
catggtttataccacgtgcttcatgggacaatttcgccaatggatgggattggaccagaa
gatattaatattccagacttactcaaacgattgcaagatgacactatagaggaagttatt
ttagcgacgaaccctaatgtggagggagaggcaactgcgatgtatatttcgcgcttgcta
aaaccatcaggcataaagataactagaatagcacatggtcttccagttggcggagatttg
gaatacgctgatgaagtgacgctctcaaaagccatggaaggacgaagagaagtataa

DBGET integrated database retrieval system