KEGG   Listeria seeligeri: lse_2633Help
Entry
lse_2633          CDS       T01184                                 

Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lsg  Listeria seeligeri
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lsg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lse_2633
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lse_2633
   00620 Pyruvate metabolism
    lse_2633
   00640 Propanoate metabolism
    lse_2633
  Energy metabolism
   00680 Methane metabolism
    lse_2633
Enzymes [BR:lsg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     lse_2633
Lipid biosynthesis proteins [BR:lsg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   lse_2633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2704771..2706348
Genome map
AA seq 525 aa AA seqDB search
MNSENLLAPELYNITDEIAKFSSEKTALIWKNEHDETKTWSYRHLLEQANKFANVAKEAG
VKKGDHVIVMTPRLLETYAIYMGLWKAGAIIIPASELLKAHDLEYRIHHANVKAIVSYNG
MTAEFDKINDIPSVAKKIIVGEKLAGWDHYETLMEQATVEFERVETSRDDACLLAFTSGT
TGNPKGVVHIHGWGYAHIRIAADHWLDIHEDDIVWATAGPGWQKWVWSPFLSVLGKGATG
FIYNGRFIPEKQLNLLSEEKINVLCCTPTEYRLMAKVNNLREHDLSSLRSAVSAGEPLNR
EVIQVFQDNFDIKVRDGYGQTESTLLIGTLVDTPIRPGSMGKPIMPEFMAIIDADGNPVG
VGEIGDIAMRRDFPALFKEYYKEPERLQKAIRGDYFVSGDRAIRDEDNYYWFQGRNDDII
ISSGYTIGPFEVEDALTHHPAVKEVAVVASPDEIRGTVVKAFIVLKDGYEGTDDLVHELQ
TFTKEQTAPYKYPRRIEFVEALPKTDSGKIRRVELRDAEFASVHK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagagaacctacttgctccagaactttataatattaccgacgagattgctaaa
tttagttctgaaaaaacggctttaatttggaaaaatgaacatgatgaaacaaaaacttgg
agctaccgtcacctgcttgaacaagcgaataagtttgcgaatgttgcgaaagaagctggc
gtaaaaaaaggcgaccatgttatcgtaatgacgcctcgcttgctcgaaacatatgcgatt
tacatgggcctatggaaagctggagccatcattattcccgcttctgaattacttaaagca
cacgatttagaataccgcatccatcatgctaatgtgaaagcaattgtttcttataacgga
atgactgctgaatttgataaaattaacgacatcccatctgttgccaaaaagattattgtt
ggcgaaaaattagctggttgggatcattatgaaacattaatggaacaggctacagtagaa
ttcgaacgggtggaaacttcccgcgatgatgcatgcttacttgctttcactagtggaaca
acaggtaatcctaaaggcgttgtacatattcatggttggggctacgcgcatattcgtatc
gccgctgatcactggctagacattcatgaagacgatattgtctgggcaactgcaggaccc
ggctggcaaaaatgggtctggtctccattcctatccgttcttggaaaaggcgcgactggt
ttcatttataatggtcgttttattcccgaaaaacaactcaacttgcttagcgaagaaaaa
atcaacgtcctatgctgtacgccaacagaatatcgcttaatggcaaaagtaaataatttg
cgcgaacatgatttaagctcccttcgcagtgctgtttcagcaggtgagccactaaaccgt
gaagtaattcaagttttccaagacaactttgacattaaagttcgtgatggatatggacaa
acagaaagcacattattgattggaacgcttgtagatacgccaattcgccccggttcaatg
ggcaaaccaattatgcctgaatttatggcgattattgatgctgatggaaacccggtcggt
gttggtgaaatcggtgatattgcgatgcgtagagatttcccagcattgtttaaagaatac
tataaagaacctgaacgtcttcaaaaagcgattcgcggtgactattttgtttctggcgac
cgtgcaattcgtgacgaagataattactactggttccaaggtagaaatgacgatatcatc
attagctctggttacacgattggaccttttgaggtggaagacgccttgactcatcaccct
gccgtgaaagaagtagctgttgtcgcaagccctgacgaaatccgcggcaccgtcgtaaaa
gctttcatcgtcttaaaagatggttacgaaggcaccgacgacctagttcacgagttacaa
acatttacgaaagaacaaaccgcaccatacaaatatccgcgccgtatcgagtttgtggag
gctttaccaaaaaccgattctgggaaaattcgtcgtgtggaattacgggatgctgaattt
gcgagtgtgcataaataa

DBGET integrated database retrieval system