KEGG   Listeria seeligeri: lse_2633Help
Entry
lse_2633          CDS       T01184                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lsg  Listeria seeligeri
Pathway
lsg00010  Glycolysis / Gluconeogenesis
lsg00620  Pyruvate metabolism
lsg00640  Propanoate metabolism
lsg00680  Methane metabolism
lsg01100  Metabolic pathways
lsg01110  Biosynthesis of secondary metabolites
lsg01120  Microbial metabolism in diverse environments
lsg01130  Biosynthesis of antibiotics
lsg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lsg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lse_2633
   00620 Pyruvate metabolism
    lse_2633
   00640 Propanoate metabolism
    lse_2633
  Energy metabolism
   00680 Methane metabolism
    lse_2633
Enzymes [BR:lsg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     lse_2633
Lipid biosynthesis proteins [BR:lsg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   lse_2633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CBH28784
Position
2704771..2706348
Genome map
AA seq 525 aa AA seqDB search
MNSENLLAPELYNITDEIAKFSSEKTALIWKNEHDETKTWSYRHLLEQANKFANVAKEAG
VKKGDHVIVMTPRLLETYAIYMGLWKAGAIIIPASELLKAHDLEYRIHHANVKAIVSYNG
MTAEFDKINDIPSVAKKIIVGEKLAGWDHYETLMEQATVEFERVETSRDDACLLAFTSGT
TGNPKGVVHIHGWGYAHIRIAADHWLDIHEDDIVWATAGPGWQKWVWSPFLSVLGKGATG
FIYNGRFIPEKQLNLLSEEKINVLCCTPTEYRLMAKVNNLREHDLSSLRSAVSAGEPLNR
EVIQVFQDNFDIKVRDGYGQTESTLLIGTLVDTPIRPGSMGKPIMPEFMAIIDADGNPVG
VGEIGDIAMRRDFPALFKEYYKEPERLQKAIRGDYFVSGDRAIRDEDNYYWFQGRNDDII
ISSGYTIGPFEVEDALTHHPAVKEVAVVASPDEIRGTVVKAFIVLKDGYEGTDDLVHELQ
TFTKEQTAPYKYPRRIEFVEALPKTDSGKIRRVELRDAEFASVHK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagagaacctacttgctccagaactttataatattaccgacgagattgctaaa
tttagttctgaaaaaacggctttaatttggaaaaatgaacatgatgaaacaaaaacttgg
agctaccgtcacctgcttgaacaagcgaataagtttgcgaatgttgcgaaagaagctggc
gtaaaaaaaggcgaccatgttatcgtaatgacgcctcgcttgctcgaaacatatgcgatt
tacatgggcctatggaaagctggagccatcattattcccgcttctgaattacttaaagca
cacgatttagaataccgcatccatcatgctaatgtgaaagcaattgtttcttataacgga
atgactgctgaatttgataaaattaacgacatcccatctgttgccaaaaagattattgtt
ggcgaaaaattagctggttgggatcattatgaaacattaatggaacaggctacagtagaa
ttcgaacgggtggaaacttcccgcgatgatgcatgcttacttgctttcactagtggaaca
acaggtaatcctaaaggcgttgtacatattcatggttggggctacgcgcatattcgtatc
gccgctgatcactggctagacattcatgaagacgatattgtctgggcaactgcaggaccc
ggctggcaaaaatgggtctggtctccattcctatccgttcttggaaaaggcgcgactggt
ttcatttataatggtcgttttattcccgaaaaacaactcaacttgcttagcgaagaaaaa
atcaacgtcctatgctgtacgccaacagaatatcgcttaatggcaaaagtaaataatttg
cgcgaacatgatttaagctcccttcgcagtgctgtttcagcaggtgagccactaaaccgt
gaagtaattcaagttttccaagacaactttgacattaaagttcgtgatggatatggacaa
acagaaagcacattattgattggaacgcttgtagatacgccaattcgccccggttcaatg
ggcaaaccaattatgcctgaatttatggcgattattgatgctgatggaaacccggtcggt
gttggtgaaatcggtgatattgcgatgcgtagagatttcccagcattgtttaaagaatac
tataaagaacctgaacgtcttcaaaaagcgattcgcggtgactattttgtttctggcgac
cgtgcaattcgtgacgaagataattactactggttccaaggtagaaatgacgatatcatc
attagctctggttacacgattggaccttttgaggtggaagacgccttgactcatcaccct
gccgtgaaagaagtagctgttgtcgcaagccctgacgaaatccgcggcaccgtcgtaaaa
gctttcatcgtcttaaaagatggttacgaaggcaccgacgacctagttcacgagttacaa
acatttacgaaagaacaaaccgcaccatacaaatatccgcgccgtatcgagtttgtggag
gctttaccaaaaaccgattctgggaaaattcgtcgtgtggaattacgggatgctgaattt
gcgagtgtgcataaataa

DBGET integrated database retrieval system