KEGG   Listeria seeligeri: lse_2673Help
Entry
lse_2673          CDS       T01184                                 

Definition
glycosyl hydrolase 1
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lsg  Listeria seeligeri
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lsg00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2747711..2749165
Genome map
AA seq 484 aa AA seqDB search
MEHKKLKPFPKDFLWGSASAAYQVEGAWDEDGKGPSVWDEFVRIPGTTFKETNGDVAVDN
YHRYKEDVALMAEQGLKAYRFSVAWSRVIPHGNGEVNEAGLKFYDNLIDELLSFGIEPVV
TLYHWDIPKGLQDEYGGWESRKVVEDFTTYAALLFERFNGRVKYWVTLNEQNVFISHGYK
LAYHPPGVSDDKRMFAANHNANLANASAIAKFRELGISGKIGPSFAYGPSYSIDANPQNV
LASENSEEFNAHFWMDVYTWGEYPTATWNWLEEHGLAPELLPGDTELLKKGKPDFMGVNY
YRSMTHAFNGADGVGSGKMNTTGKKGTSEETGVPGLYKNTNNPYLEKTNWDWDIDPTGLR
IGLRRITNRYKLPIMITENGLGEYDSLTEDHKVHDEYRIEYIRAHALAIQEAITDGVEML
GYCTWSFTDLLSWLNGYQKRYGFVYVDRDENDEKELKRYKKDSFYWYKKTIEANGANLTE
EQGK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggaacataaaaagttgaaacctttcccaaaggattttctctggggatcagcttctgca
gcgtaccaagtggaaggtgcttgggatgaggatggtaaagggccatctgtatgggatgag
tttgttcgcattcccggaacaacatttaaagaaacaaacggagatgtggcggtggataat
taccatcgttataaagaagatgttgcgcttatggctgaacaaggcttgaaagcgtatcgt
ttctccgttgcttggagccgagttattccacatggcaacggagaagtaaacgaagctgga
ttaaagttctatgataatttgattgatgagctactttctttcgggattgagcctgttgtg
acactttatcattgggatattccaaaagggcttcaagatgagtacggtggctgggaatct
cgcaaagtcgttgaagatttcactacttatgctgccctactttttgaacgcttcaacggt
cgcgtgaagtactgggtaactcttaatgaacaaaacgtctttatctcacatggttacaaa
ttggcgtatcatccacctggcgtttccgatgataaacggatgtttgcggcgaatcacaat
gctaacttagcaaacgcttctgccattgctaaattccgcgaactaggtatttccggaaaa
attggtccaagttttgcctacggaccaagttattcaattgatgccaacccgcaaaacgta
ttagcttctgaaaactccgaagaatttaacgctcacttttggatggatgtttacacatgg
ggcgaataccctactgctacttggaactggttggaagaacacggcctcgcaccagaactt
ttaccaggcgataccgaacttctgaaaaaaggcaaaccagattttatgggggtcaattat
tatcgttcgatgacacatgcctttaacggcgcagatggtgttggttctggaaaaatgaat
actactggcaaaaaaggcacttctgaggagactggtgtaccggggttatacaaaaacacc
aataatccttatctcgaaaaaacaaactgggactgggatattgatccaactggacttcgc
atcggcttacgtagaattactaaccgctacaaattgccgattatgattactgaaaatggt
cttggcgaatatgatagcttaacagaagatcacaaggtgcatgatgaataccgaatagag
tatattcgcgcacatgctctagcaatccaagaagcaattaccgatggcgtagaaatgctt
ggttactgcacttggagcttcactgatttattaagttggttaaatggttatcaaaaacgt
tacggtttcgtttatgtagaccgcgacgaaaatgatgaaaaagaactaaaacgctataag
aaagacagtttttactggtataaaaagacaattgaagctaatggagctaatttaacagag
gaacagggcaaataa

DBGET integrated database retrieval system