KEGG   Lactobacillus salivarius CECT 5713: HN6_00010Help
Entry
HN6_00010         CDS       T01962                                 

Gene name
asnB
Definition
Asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lsi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HN6_00010 (asnB)
Enzymes [BR:lsi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     HN6_00010 (asnB)
Peptidases [BR:lsi01002]
 Cysteine Peptidases
  Family C44
   HN6_00010 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14129..16051
Genome map
AA seq 640 aa AA seqDB search
MCGFVGYVNQTDVQDDVIEKMANRIRHRGPDDEAFFRDNNVSMGFRRLSIIDLAHGKQPM
YNQDQTKVLTFNGEIYNYKEIRKELKELGYNFRTEVDSEVLIHGYDAWGPELLQKTRGMY
AFAIYNQKENEVFLARDHFGIKPLYYYDDGETFLWASEIKAFLDHPNFKKEFNKELLPIH
LSFEFIPSKETMFKHVYKVMPGQYVIHKNGKTEVHQYYKFNYDKIDNSQTVESDASQIRK
LVRESVDAHMVADVEVGSFLSSGVDSSYVFNEATKIKKQHIQSFTLGYDRSKYSEIDWAH
DFAEGIGQKNTPIKIDADDYFGILPTIMYYMDEPLSNPSAMQLYFLSKGTREHVKVALSG
EGADEFFGGYNTYLEAGPFERYQKWVPGFVRKGLAKAVENLPRFHGQRFLVRGAQPLSER
YYRVNYVYNYHEREKILKDKSLNVDTGAYTKHIFDEVKDKDEMTQMQYFDINTWLPFDIL
QKADRMSMANSLEVRTPLVDREVAKFAATMPIKTRIQGDTTKISLRKAAQAELPEKVANK
EKLGFPSPVAQWMKEPKYKKMIEDAFTSDVAKKFFDIDALLEIFKEHLNGKSSMQKIFTI
YTFILWYQVYFPEDCEHDIRDQIRFNNVKAHANEQNFAEA
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggatttgtcggttatgttaaccaaacagatgtccaagatgatgtaattgaaaag
atggctaatcgaattcgtcaccgtggacctgatgatgaagctttctttagagataacaat
gtttctatgggatttcgtcgtttatcaattattgacttagctcatggtaaacaacctatg
tataaccaagaccaaaccaaagtattaacctttaatggtgaaatttataactataaagaa
attagaaaagaacttaaagaattaggatataactttagaacagaagttgactcagaagtt
ttaatccatggctatgatgcttggggcccagagttgcttcaaaagactcgaggtatgtat
gctttcgcaatctataaccaaaaagaaaacgaagtatttttagctcgtgatcattttgga
attaaaccattgtactactatgatgatggtgaaacattcttatgggcttctgaaatcaaa
gctttcttagatcatccaaacttcaagaaggaattcaataaggaactactacctattcat
ttgagttttgaatttattccttccaaggaaacaatgtttaaacatgtttataaagttatg
ccaggtcaatatgtaattcataagaatggcaagactgaagtacatcaatattataaattt
aattatgataagattgacaactcacaaacagtagaaagcgatgctagtcaaattcgtaaa
ttagtacgtgaatctgttgatgcgcatatggttgcggacgttgaagtaggtagtttctta
tctagtggtgttgactcaagttatgtatttaatgaagcaacaaaaattaagaaacaacat
attcaatcatttacattaggatatgatcgttctaaatatagcgaaattgactgggcacat
gattttgctgaagggattggtcaaaagaatacaccaatcaagattgatgcagatgattat
tttggtattttaccaacaatcatgtattacatggatgaaccattatctaatccatctgct
atgcaattatacttcttatcaaaaggtacacgtgaacacgttaaggttgctttatctggt
gaaggtgcagatgaattctttggtggatataatacataccttgaagctggtccattcgaa
cgttatcaaaaatgggtaccaggctttgtacgtaaaggtttagctaaagcagttgaaaac
ctacctcgtttccatggtcaacgtttcttagttcgtggtgcacaaccattgagtgaacgt
tactaccgtgtaaactatgtttataactaccatgaacgtgaaaaaatcttaaaagataag
agtttaaatgttgatacaggtgcatatacaaagcacatctttgatgaagtaaaagataaa
gatgaaatgacacaaatgcaatactttgatatcaacacttggttaccatttgatatctta
caaaaagctgatcgcatgagtatggcaaactcacttgaagttcgtacaccgttggttgac
cgtgaagttgctaaatttgcagctacaatgccaattaagactcgtattcaaggtgataca
actaagatttctttacgtaaagcagcacaagcagaattacctgaaaaagttgctaataag
gaaaaattaggtttcccatctccagttgctcaatggatgaaagaacctaagtacaagaag
atgatagaagatgccttcacatctgatgttgccaagaaattctttgatattgatgcatta
cttgaaatcttcaaagaacatttgaatggtaaatcaagtatgcaaaagatttttacaatc
tatacatttattttgtggtatcaagtatacttccctgaagactgtgaacatgacattagg
gatcaaattcgttttaacaatgttaaagcacatgcaaatgaacagaattttgcagaagct
taa

DBGET integrated database retrieval system