KEGG   Lactobacillus salivarius CECT 5713: HN6_00012Help
Entry
HN6_00012         CDS       T01962                                 

Gene name
murE
Definition
UDP-N-acetylmuramyl-tripeptide synthetase (UDP-MurNAc-tripeptide synthetase) (EC:6.3.2.-)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lsi00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    HN6_00012 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HN6_00012 (murE)
Enzymes [BR:lsi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     HN6_00012 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20218..21750
Genome map
AA seq 510 aa AA seqDB search
MALEITPALSLLDEHHLLKEVVNEQKLTFENVTYDSRKVSDNTLFFCKGNFKPSYLTSAL
EKGATAYVSEQKYAEGMDATGIIVTNVQKAMALLGAAFYGFPQNELFIIAYTGTKGKTTS
AYFAEHILAKATDKKVALFSTIDRVLGNEPDQRFKSDLTTPESLDLFHDMRAAVNNGMTH
LVMEVSSQAYKKNRVYGLTFDVGVFLNISPDHIGRNEHPTFDDYLHCKEQLLVNSKRCVI
NGETAYLRDVYYTAKATTEPEDIYVFARKGAQISDNIPVDIEYQNDFEDLHKSVIEVKGL
SDKAQTLHVDGKYELSVPGDYNEGNATSAIIATLLAGAKGEDARKTLDRVHIPGRMEIIK
TKNNGTIYVDYAHNYASLKALFAFLKQQTHAGRVIAVLGSPGDKGISRRPGFGKAVSEEV
DHVILTTDDPGFEDPMKIAQEIDSYINHDNVKVEFELDREMAIEKAIKMSTNNDIVVLAG
KGEDPYQKIKGVDVPYPSDVNVAKKIVEEL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcattagaaataaccccagctttatctttattggatgaacaccacctcttaaaagaa
gtggttaacgaacaaaaattgacttttgaaaatgtaacttatgattcaagaaaagtgtca
gataatactttgtttttctgtaaaggtaattttaaacctagttatttaacttcagctttg
gaaaaaggtgcaacagcctatgtttctgaacaaaagtatgctgaaggaatggatgcgaca
ggtattattgtaactaacgtacaaaaagcgatggcactattaggtgcagcattctatggt
tttcctcaaaatgagttatttattattgcttatacaggaacaaaaggaaagactacttca
gcttattttgcggagcatattctagcaaaagcaacagataaaaaagtagctcttttttca
actattgatagagtgttgggaaatgaacctgatcaaagatttaaatcagatttaacaact
ccagaatcacttgatttattccatgatatgagagctgcagttaataatggtatgactcat
ttggtaatggaagtttcatcacaggcatacaagaagaatcgtgtgtatggacttacattt
gatgtgggggtattcttaaatatctcaccagatcatattggtagaaatgaacatccaaca
tttgatgattatcttcattgtaaggaacaactcttagtaaattctaagcgttgtgtgatt
aatggagaaacagcttatttgagagatgtttactatactgcaaaagcaacaacagaacca
gaagatatatatgtttttgcacgcaagggtgctcaaatttctgacaacattccagtagat
attgaatatcaaaatgattttgaagatttgcataaaagtgtaattgaggttaagggactt
agtgataaggctcaaaccttacatgttgatggaaagtatgaattaagtgtgccaggcgat
tataacgaaggaaatgctactagtgcgattatcgctactttacttgcaggtgctaaaggt
gaagatgcacgcaagacacttgatagagtacatattcctggtagaatggaaattattaaa
acaaaaaataatggtacaatctatgttgattatgctcataattatgctagtttaaaagct
ttatttgcctttttaaaacaacaaactcatgccggtcgagtaattgctgttttgggttct
cctggagataagggtatttctcgtcgtccaggtttcggaaaagcagttagtgaagaagtg
gatcatgtgattttgacaacggatgatccaggctttgaagatccaatgaagattgctcaa
gaaattgatagttatatcaaccatgataatgtaaaagtagagtttgaactagacagagaa
atggcaattgagaaagccattaaaatgagtactaataacgatatagtagtattagcaggt
aaaggagaagatccttatcaaaagataaagggtgtcgatgtaccttatccatcagatgtt
aatgtagcaaagaaaattgtggaggaattataa

DBGET integrated database retrieval system