KEGG   Lactobacillus salivarius CECT 5713: HN6_00092Help
Entry
HN6_00092         CDS       T01962                                 

Gene name
glpK
Definition
Glycerol kinase (ATP:glycerol 3-phosphotransferase) (Glycerokinase) (GK) (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lsi00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
126619..128136
Genome map
AA seq 505 aa AA seqDB search
MMSDKYIMAIDEGTTSTRAIIFDKKGNKVAEGQKEFRQYFPQPGWVEHDANEIWNAVLST
IANSFISSGIQPKQIAGIGITNQRETTIIWDKETGLPIYNAIVWQSRQTSDIAQKLIDEG
YSDTIHEKTGLIIDAYFSATKIRWILDHVEGAQERAEKGELLFGTIDTWLTWKLTGGKVH
VTDYSNASRTMLFNIHDLKWDKEILELLNIPEALLPEVKGNSEIYGQTAAYHFFGSQVPI
SGMAGDQQSALFGQLALEDGTVKNTYGTGSFIVMNTGNKPVLSDNNLLTTIGYSIDGKIN
FALEGSVFVSGSALQWLRDSMEIIESAPESERAANESTNHNEVYVVPAFTGLGAPYWDSD
ARGAVFGLTRGTTKNDFIKATLQSLAYQTRDVLDTMEKDTGIKIPVLRVDGGAAMNNYLL
QFQSDLLNKSVERAGNLETTALGVAFLAGLAVGFWKDTDELKELFTVGRRFEPEMSDDAR
EYLYAGWKNAVEATRIFKHKINENL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcagataaatatattatggctatcgacgaaggtactacaagtacacgtgcgatt
atcttcgacaaaaaaggaaataaagttgctgaaggacaaaaagaatttcgtcaatatttc
cctcaaccaggttgggtagaacatgacgctaatgaaatttggaacgcagtattatcaaca
atagctaattcttttattagctcaggaatacaaccaaaacaaattgcaggtattggtatt
actaaccaacgtgaaacaactattatttgggacaaagaaacaggattaccaatttataac
gctattgtttggcaatcaagacaaacaagtgacattgcacaaaaattaattgatgaaggt
tattctgatactattcatgaaaagacaggtttaatcattgatgcctacttctcagcaaca
aagattcgttggatcttagatcatgtagaaggtgctcaagaacgtgctgaaaaaggtgaa
ttgttattcggtacgattgatacatggcttacatggaaattaacaggtggtaaagttcac
gtaacagattattcaaatgctagtcgtacaatgctgtttaacattcatgatttgaaatgg
gacaaggaaattttagaattattgaatattcctgaagctctattaccagaagttaaagga
aattctgaaatctatggtcaaactgcagcataccacttctttggtagtcaagttcctatt
tccggtatggctggtgaccaacaatctgctttattcggtcaattagctttagaagatgga
acagttaagaatacttatggtacaggttcatttatcgtaatgaatacaggtaataaacca
gttctttccgataataacttactaacaactattggatattctattgatggcaagattaat
tttgctttagaaggttcagtatttgtatctggttcagcacttcaatggttaagagatagt
atggaaattattgaatcagctcctgaatcagaaagagcagcaaatgaatcaactaaccat
aatgaagtttacgttgttccagcctttacaggtttaggtgctccttactgggatagtgat
gctcgcggggcagtgtttggattgacacgtggtacaactaagaatgactttattaaagct
actttacaatcacttgcttaccaaacaagagatgtattagatacgatggaaaaagataca
ggtattaagattccagtccttcgtgttgacggtggagctgctatgaataattacttgtta
caattccaatctgatttgcttaataagtcagttgaaagagctggaaacttagaaacaaca
gctctaggtgtagctttcttagctggattggcagttggtttctggaaagacacagatgaa
ttgaaagaattatttacagttggtcgcagatttgaaccagaaatgtccgatgatgctaga
gaatatctatatgctggatggaagaacgcagtagaagcaacacgtatattcaaacataaa
ataaacgaaaatctttag

DBGET integrated database retrieval system