KEGG   Lactobacillus salivarius CECT 5713: HN6_00113Help
Entry
HN6_00113         CDS       T01962                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lsi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HN6_00113
  Amino acid metabolism
   00300 Lysine biosynthesis
    HN6_00113
Enzymes [BR:lsi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HN6_00113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
150920..152068
Genome map
AA seq 382 aa AA seqDB search
MEEKEKIKILQDLIQINSVNGNELEVAEYLHKLFAKSNLESKVDEFGDRRANLVLDVGQS
EKVLGLTGHMDTVALGNEDKWSYPPLEAKIDGDRLYGRGAADMKSGLAALAIAIIELSDL
GKIPGHIRFIATAGEEYGTPGANRLRDLGVAKDLDALVVGEATNGDIIYAHSGSFNYRIV
SHGKSVHSSTPELGNNALDALVDFAAIERTLFDDVPRDPYLGELKHSITILNVGEQVNTI
PDEGELYGNIRPTSAFNNKQIVERLKSAVDEVNDKNGAKLTFELIHDWYPVVSNPEDDFV
QTALTVSQEVFSNYVEGKQPELITMNGATDASVFVKDNTNLPVIILGPGESNVSHQIDEY
TTISSYLALVEIYKQIILRYFE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaaagaaaagattaaaattttgcaggatttaatacaaattaattcagttaat
ggaaatgaattagaagtagcagaatatttacacaagctttttgcaaaatcaaatttagaa
tcaaaggttgatgaatttggtgatagaagagctaatttagtactagatgttggacaaagc
gagaaagtactaggacttacaggacatatggatactgttgcattaggaaatgaagataag
tggagctatcctccattagaagctaaaattgatggtgacagattatatggacgtggagca
gctgacatgaagagtggcttggcagctttagcaatagcaattattgaattatcagatttg
ggaaaaataccaggacatattagatttattgcaactgctggcgaagagtatggtacacca
ggagctaacaggctaagagatttaggagtagctaaagatctagatgcattagttgtaggt
gaagcaactaatggagatataatatatgcacattctgggagtttcaattatcgtatcgta
agtcatggaaaatctgttcattcatcaacaccagaattgggaaataatgcattagatgct
ttagttgattttgctgctatagaacgtacactttttgatgatgttcctcgcgacccatat
ttaggtgaactaaaacatagtataaccattttaaatgtgggtgaacaagttaacacaatt
cctgatgaaggggaactttatggaaatattcgtccaactagtgcttttaataataaacaa
atagttgaacgtttaaaatcagcggtagatgaagtgaatgataaaaatggggctaaactc
acttttgaattaattcatgactggtatcctgttgtttcaaatccagaagatgattttgta
cagacagcattaactgttagtcaagaagtattctctaattatgttgaaggtaagcaacca
gaattgataacaatgaatggggctactgatgcatctgtttttgtaaaagataacactaac
ttacctgttataattttagggcctggtgaaagtaatgtaagtcatcagatcgatgaatat
acaacaatttctagttatttagcattggtagaaatttacaaacaaataatattgagatat
tttgaatga

DBGET integrated database retrieval system