KEGG   Lactobacillus salivarius CECT 5713: HN6_00319Help
Entry
HN6_00319         CDS       T01962                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lsi00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lsi00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:lsi00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
420531..422726
Genome map
AA seq 731 aa AA seqDB search
MVDLITVDKENRVFHLHNEQLSYIFSIEDGDTISHLYFGKRVKSYHGQLRYPRVDRGFSG
NLPGSLDRTFSKDTLPQEYSSAGEMDYRVPATVVRQKDGSNGLMLKYKTYKVEEGKPELT
GLPAAYVESESEANTLIVTLEDEKSGVLFDLLYTIYRDYPIITRSVKVKNLGQENVNLEK
VASMQIDFSQRDFDVISLPGAHVNERHLERQKLGYGIQTFGSIRGTSSHQMNPFVALVDS
NTDEFNGAAYGFALVYSGNHAFEIEKDQLDQVRLLVGINSYNFNWQLPAGESFQTPEVLM
TYTDNGLNAMSKAFHSIIRDRITRSKYKYKERPILVNNWEATYFDFDEDKLKPIVDEAKE
LGIEMFVLDDGWFGHRDDDNSSLGDWNVYEKKFPQGLKHFADYVHSKDLKFGIWFEPEMI
SMDSELYRSHPEYLMQVPGRQPSPSRNQYILDMTRKDVRDDIVDQVSTIIADNDIDYVKW
DMNRNLSDIYSQNLPADRQGEVYHRYVLGVYDILERITSKFPDVLFEGCSGGGGRFDAGF
VYYMPQSWTSDNTDAIARLTIQYGTSLVYPPSMMTAHVSAVPNHQTGRVTPIDTRGAVAM
SAVFGYELDLTILTDEEKEIVKKQVNQYKGIRKLVQYGDFYRLQSSKDGNKTAWMFVSPQ
KDEAVVMVCKVLTEAQPVLTKTKLYGLDTNRDYRDVETNKVYGGDELMELGFYDPIIRND
YAATMYHFKAE
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggtagatttaattacagtagataaagaaaatcgagtttttcatttgcataatgagcaa
ctttcatatattttttcaattgaagatggcgatacgattagtcatttgtattttggtaaa
agggtaaaaagttatcatggacaattacgttatccacgagtagatagaggattttctggt
aatttaccaggtagtttagatagaaccttttctaaggatactttgccacaagaatatagt
agtgccggtgagatggattatcgagttccagcaacagtagtgcgtcaaaaagatggctca
aatggattaatgctaaaatataagacttacaaagttgaagaaggaaaacctgaattgaca
ggacttccagcagcttatgtagagtcagaatcggaagctaatactttgatcgttacgctt
gaagacgagaaaagtggagttttatttgacttactatatacaatatatcgtgattatcca
attattacacgttcagttaaggttaagaatctaggacaagaaaatgtaaacttggaaaaa
gttgcatctatgcaaatagatttttctcaacgagactttgatgtaattagtttaccagga
gcacatgtaaatgaacgtcatttggaaagacaaaaattaggatatggaatccaaacattt
ggtagcattcgtggtacttctagtcatcaaatgaatccatttgttgccttggttgatagt
aatactgatgaattcaatggtgctgcatatggttttgcgttagtttactcaggaaaccat
gcttttgaaattgaaaaagatcaacttgatcaagttcgattattagtaggaattaatagt
tataatttcaattggcaattaccagcaggggaaagtttccaaactccagaagtattaatg
acatatactgataatggattgaatgctatgagtaaggcatttcatagtattatcagagat
agaattacacgttccaaatataaatataaggaacgcccaattctagttaataattgggaa
gctacatattttgactttgatgaagataaattaaagccaatcgtagacgaagccaaggaa
ctggggatagagatgtttgtattagatgatggatggtttggtcatcgcgatgacgataat
tcatcattaggtgattggaatgtatacgagaaaaaattccctcaaggcttaaaacatttt
gcagattacgtacacagcaaagatttgaaatttggtatttggtttgaaccagaaatgatt
tcaatggattcggaattatatagaagccatcctgaatatttgatgcaagttccaggaaga
caaccaagtccatcacgtaatcaatatattttagatatgacaagaaaagatgtcagagat
gacatagttgatcaggtttcaactattattgctgataatgacattgattatgttaagtgg
gatatgaatcgtaatttatctgatatctattcacaaaatctacctgcagatagacagggt
gaagtttatcatcgctatgttttaggggtttatgatattttagaaagaataactagcaag
ttcccagatgttttatttgaaggttgctctggcggtggtggacgatttgatgcaggtttt
gtttactacatgccacaaagctggactagtgataatacggacgcgattgccagattaact
attcaatatggtacaagtttagtatatccaccatcaatgatgacagctcatgtatctgca
gttccaaatcatcaaactggtagagtgacaccaatcgatactagaggtgcagttgctatg
agtgcagtctttggttacgagttagacttgacaatattaacagacgaagaaaaagaaatt
gttaaaaaacaagtaaatcaatacaagggcattagaaaattagtccaatacggagatttc
tatcgtttacaatcttctaaagatggtaataaaacagcttggatgtttgtaagccctcaa
aaagatgaagcagtagtaatggtatgtaaagttttaacagaagctcaacctgtattaacg
aaaactaaattatatggcttggataccaatagggactaccgtgatgttgaaactaataag
gtttatggtggcgatgaattaatggaattaggattctatgatcctattatccgtaatgac
tatgctgctacaatgtatcattttaaagctgaataa

DBGET integrated database retrieval system