KEGG   Lactobacillus salivarius CECT 5713: HN6_00319Help
Entry
HN6_00319         CDS       T01962                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lsi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    HN6_00319
  Lipid metabolism
   00561 Glycerolipid metabolism
    HN6_00319
   00600 Sphingolipid metabolism
    HN6_00319
Enzymes [BR:lsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     HN6_00319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
420531..422726
Genome map
AA seq 731 aa AA seqDB search
MVDLITVDKENRVFHLHNEQLSYIFSIEDGDTISHLYFGKRVKSYHGQLRYPRVDRGFSG
NLPGSLDRTFSKDTLPQEYSSAGEMDYRVPATVVRQKDGSNGLMLKYKTYKVEEGKPELT
GLPAAYVESESEANTLIVTLEDEKSGVLFDLLYTIYRDYPIITRSVKVKNLGQENVNLEK
VASMQIDFSQRDFDVISLPGAHVNERHLERQKLGYGIQTFGSIRGTSSHQMNPFVALVDS
NTDEFNGAAYGFALVYSGNHAFEIEKDQLDQVRLLVGINSYNFNWQLPAGESFQTPEVLM
TYTDNGLNAMSKAFHSIIRDRITRSKYKYKERPILVNNWEATYFDFDEDKLKPIVDEAKE
LGIEMFVLDDGWFGHRDDDNSSLGDWNVYEKKFPQGLKHFADYVHSKDLKFGIWFEPEMI
SMDSELYRSHPEYLMQVPGRQPSPSRNQYILDMTRKDVRDDIVDQVSTIIADNDIDYVKW
DMNRNLSDIYSQNLPADRQGEVYHRYVLGVYDILERITSKFPDVLFEGCSGGGGRFDAGF
VYYMPQSWTSDNTDAIARLTIQYGTSLVYPPSMMTAHVSAVPNHQTGRVTPIDTRGAVAM
SAVFGYELDLTILTDEEKEIVKKQVNQYKGIRKLVQYGDFYRLQSSKDGNKTAWMFVSPQ
KDEAVVMVCKVLTEAQPVLTKTKLYGLDTNRDYRDVETNKVYGGDELMELGFYDPIIRND
YAATMYHFKAE
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggtagatttaattacagtagataaagaaaatcgagtttttcatttgcataatgagcaa
ctttcatatattttttcaattgaagatggcgatacgattagtcatttgtattttggtaaa
agggtaaaaagttatcatggacaattacgttatccacgagtagatagaggattttctggt
aatttaccaggtagtttagatagaaccttttctaaggatactttgccacaagaatatagt
agtgccggtgagatggattatcgagttccagcaacagtagtgcgtcaaaaagatggctca
aatggattaatgctaaaatataagacttacaaagttgaagaaggaaaacctgaattgaca
ggacttccagcagcttatgtagagtcagaatcggaagctaatactttgatcgttacgctt
gaagacgagaaaagtggagttttatttgacttactatatacaatatatcgtgattatcca
attattacacgttcagttaaggttaagaatctaggacaagaaaatgtaaacttggaaaaa
gttgcatctatgcaaatagatttttctcaacgagactttgatgtaattagtttaccagga
gcacatgtaaatgaacgtcatttggaaagacaaaaattaggatatggaatccaaacattt
ggtagcattcgtggtacttctagtcatcaaatgaatccatttgttgccttggttgatagt
aatactgatgaattcaatggtgctgcatatggttttgcgttagtttactcaggaaaccat
gcttttgaaattgaaaaagatcaacttgatcaagttcgattattagtaggaattaatagt
tataatttcaattggcaattaccagcaggggaaagtttccaaactccagaagtattaatg
acatatactgataatggattgaatgctatgagtaaggcatttcatagtattatcagagat
agaattacacgttccaaatataaatataaggaacgcccaattctagttaataattgggaa
gctacatattttgactttgatgaagataaattaaagccaatcgtagacgaagccaaggaa
ctggggatagagatgtttgtattagatgatggatggtttggtcatcgcgatgacgataat
tcatcattaggtgattggaatgtatacgagaaaaaattccctcaaggcttaaaacatttt
gcagattacgtacacagcaaagatttgaaatttggtatttggtttgaaccagaaatgatt
tcaatggattcggaattatatagaagccatcctgaatatttgatgcaagttccaggaaga
caaccaagtccatcacgtaatcaatatattttagatatgacaagaaaagatgtcagagat
gacatagttgatcaggtttcaactattattgctgataatgacattgattatgttaagtgg
gatatgaatcgtaatttatctgatatctattcacaaaatctacctgcagatagacagggt
gaagtttatcatcgctatgttttaggggtttatgatattttagaaagaataactagcaag
ttcccagatgttttatttgaaggttgctctggcggtggtggacgatttgatgcaggtttt
gtttactacatgccacaaagctggactagtgataatacggacgcgattgccagattaact
attcaatatggtacaagtttagtatatccaccatcaatgatgacagctcatgtatctgca
gttccaaatcatcaaactggtagagtgacaccaatcgatactagaggtgcagttgctatg
agtgcagtctttggttacgagttagacttgacaatattaacagacgaagaaaaagaaatt
gttaaaaaacaagtaaatcaatacaagggcattagaaaattagtccaatacggagatttc
tatcgtttacaatcttctaaagatggtaataaaacagcttggatgtttgtaagccctcaa
aaagatgaagcagtagtaatggtatgtaaagttttaacagaagctcaacctgtattaacg
aaaactaaattatatggcttggataccaatagggactaccgtgatgttgaaactaataag
gtttatggtggcgatgaattaatggaattaggattctatgatcctattatccgtaatgac
tatgctgctacaatgtatcattttaaagctgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system