KEGG   Lactobacillus salivarius CECT 5713: HN6_00373Help
Entry
HN6_00373         CDS       T01962                                 

Gene name
rbsK
Definition
Ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lsi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HN6_00373 (rbsK)
Enzymes [BR:lsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     HN6_00373 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
466658..467581
Genome map
AA seq 307 aa AA seqDB search
MSNKVTVLGSLNVDTILRIPRLPQPGETLKMDDIGVAGGGKGANQAISAARSKSHVTFIG
GVGNDVQGEMMLKLLKEDGININNVAKLNEGTGQAFILLQESGENSIVIYGGANQAIKTT
VIQNAMNDIKDSDFLVAQFETPLEVTNEAFKLARELNVKTILNPAPATDILDELKKNIDL
IIPNETEAELLTGIKVVDEDTCSKAADKLIDQGINNVIITLGKQGAYYKTKDGVCELVPA
FKVKAIDTTAAGDTFIGALVSKLDTSFSNLREAIIYASKASSLAVQRLGAIPSIPYKDDV
EKQLNSK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataaagtaacagttttgggaagcttgaatgttgatactattctgagaataccc
agattaccacagccaggtgaaacattgaaaatggacgatataggtgttgcaggcggagga
aagggagcaaatcaagctatttcagctgctagatctaaatcacatgtaacatttattggt
ggagttggcaatgatgttcaaggtgagatgatgttgaaactcctaaaagaagatggaatt
aatattaataatgttgcaaaattaaatgaaggaactggtcaagcgtttattttattgcaa
gaaagtggtgaaaatagcattgtaatctatggtggtgcaaaccaagccataaaaaccact
gttatacaaaatgcaatgaatgatataaaggatagtgattttttagtagcccaatttgaa
acacctctagaagtgacaaatgaagcatttaaattagcacgtgagttaaatgtaaagaca
attttgaatccagcaccagcgactgatattttagacgaactaaagaaaaatatagattta
ataattcctaatgaaacagaggctgaattgttaactggaataaaagtagttgacgaagat
acatgtagtaaagcggctgacaaattaattgatcaaggtattaacaatgttattattact
ttaggtaagcagggggcttattataaaacaaaagatggcgtttgtgaattagtacctgct
tttaaagttaaagcgattgatactacagctgctggtgatacatttatcggtgctctagta
tctaaattagatactagttttagcaatttaagggaagctattatttatgcaagtaaggct
tcttctctagctgtccaaagattaggtgcaattccatcaataccatataaagatgatgta
gaaaaacagttaaatagtaaatag

DBGET integrated database retrieval system