KEGG   Lactobacillus salivarius CECT 5713: HN6_00451Help
Entry
HN6_00451         CDS       T01962                                 

Gene name
nei
Definition
Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (AP lyase mutM) (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:lsi00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    HN6_00451 (nei)
Enzymes [BR:lsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     HN6_00451 (nei)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     HN6_00451 (nei)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
540045..540668
Genome map
AA seq 207 aa AA seqDB search
MISHLRMEGKYFVEPSTKEVEKHTHVVFDFTDGTSLRYNDVRKFGRMQLVKTGVEMQTAG
LAKLGPEPKEETFIVEDFSKNLKRRKKAIKNALLDQTIVAGLGNIYADEVLWMSKIHPET
PANKLTEEEVKVLRDNIIKELALATEAGGTTIRSYTDAFRHSGGFQFSLHAYQRTGDPCE
RCGTPIQRIVVGQRGTHFCPKCQVVKS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgatttcccatttgagaatggaagggaaatatttcgttgaaccaagtacaaaagaagtt
gaaaaacatacccacgtagtatttgattttacagatgggacatcacttagatataacgat
gttagaaagtttggcaggatgcaattggttaaaacaggagtggaaatgcaaactgctggc
ttagctaaattagggccagaacctaaagaggaaacatttatagttgaagatttttctaaa
aatttgaaaaggagaaaaaaagctataaaaaatgccttattagatcaaacaatagtggca
ggtttgggaaatatttatgcagatgaagtgttgtggatgagtaaaatccatcctgaaaca
ccagcaaataaattaactgaagaggaagttaaagttttacgagataatattattaaagag
ttagcgttagctaccgaagctggaggaactacaatcagatcatatacagatgcatttaga
cattctggaggatttcagtttagcttacatgcttatcaaagaacaggagatccttgtgag
agatgcggaacaccaattcaaagaattgttgtaggtcagagaggaacacatttttgtcct
aagtgtcaggtggtaaaatcatga

DBGET integrated database retrieval system