KEGG   Lactobacillus salivarius CECT 5713: HN6_00542Help
Entry
HN6_00542         CDS       T01962                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lsi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HN6_00542 (gmk)
Enzymes [BR:lsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     HN6_00542 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
652205..652822
Genome map
AA seq 205 aa AA seqDB search
MAKRGMLIVLSGPSGVGKGTVRKEIFSQPGNKFHYSVSMTTREMRPGEVNGKDYYFVSKE
EFEQEIAAGQMLEYAQYVDNYYGTPLKYVNEMLDSGKDVFLEIEVKGAMQVREKAPDGLF
IFLTPPDLMELRQRIINRGTDDIDTINKRMKKAVDEIEMMQNYDYAVVNDEVEKAAEKIK
TIIRAERWRVKRFLPDYRKQLGELN
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaagaggtatgttgattgttctttctggcccttcaggtgttggaaaaggaact
gtcagaaaagagatattttcacaaccaggtaataaatttcattattctgtttctatgaca
acaagagaaatgcgtcctggagaagtaaacggtaaagattactattttgtatcaaaggaa
gaatttgaacaagaaattgctgctggacaaatgctagagtatgcacaatacgtagataat
tattatggtactccattgaagtatgttaatgagatgcttgatagtggtaaggatgtattt
ttagagattgaagttaaaggtgctatgcaagttagagaaaaggctccggatggcttattt
attttccttacaccaccagatttgatggagttgagacagcgcattattaatcgaggtact
gatgatattgatactattaataaacgtatgaaaaaagcagtagatgagatagaaatgatg
caaaattatgattatgctgttgtaaatgacgaagttgagaaggcagccgaaaaaattaaa
acaataattagagcagaacgctggagagtaaagcgtttcttgccagactatcgaaaacag
ttaggagagttgaattaa

DBGET integrated database retrieval system