KEGG   Lactobacillus salivarius CECT 5713: HN6_00623Help
Entry
HN6_00623         CDS       T01962                                 

Gene name
folA
Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HN6_00623 (folA)
   00670 One carbon pool by folate
    HN6_00623 (folA)
Enzymes [BR:lsi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     HN6_00623 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
757274..757777
Genome map
AA seq 167 aa AA seqDB search
MISFVWAEDQKHQIGYKGHLPWRLPADLAHFKEVTMGHPMVMGKKTFDSFPGLLPRRQHI
VLTHDTNLKEKYKDNPQVEIMNSIDELTSWLDENQFQEVSVIGGAMLFNLLLNKVDKLYK
TEILSEFNGDTVMPTINYDEFKLVSKKIGKVDEKNKYPYVFLEYERK
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgatttcatttgtatgggcagaagatcaaaaacatcaaataggatataaaggacattta
ccttggagacttccagccgatttggctcattttaaagaagttacaatgggtcatccaatg
gtaatggggaagaaaacgtttgatagttttcctggtttattaccaagacgtcaacatata
gtgttaacccatgatactaacttaaaagaaaagtataaagataatccccaagtagaaatt
atgaattctattgatgaattaacttcttggttagatgaaaatcagtttcaagaagttagc
gttattggtggagcgatgttattcaacttacttcttaataaagtagataaattatataag
actgaaatactaagtgagtttaatggcgatacggttatgcctactattaattatgatgaa
tttaaacttgtttcaaaaaaaatcggtaaggtagatgaaaaaaacaagtatccttatgta
tttttggaatacgaaagaaaataa

DBGET integrated database retrieval system