KEGG   Lactobacillus salivarius CECT 5713: HN6_00643Help
Entry
HN6_00643         CDS       T01962                                 

Gene name
recD
Definition
Exodeoxyribonuclease V alpha chain (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lsi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HN6_00643 (recD)
Enzymes [BR:lsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     HN6_00643 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
775929..777755
Genome map
AA seq 608 aa AA seqDB search
MAGRIYNNYTNSTLEIIHEDPYRLSVDIDGISFTKADQIAQQFGFASDSPGRIRGAIFQS
LYDLTYATGNTYVELKPLVTETLKLLESNRNEAIDPQLVADQLIKLAEEDKIKSDDNKVY
SRTFFNAEWNIAENLYRLLKSGNSDLPNNDALLDKLLIKAEDQLEIDYDSEQKRAIKDAI
KSPVFLLTGGPGTGKTTIINGIVAVYALLNDIDLDIGKYDKDNPFPILLAAPTGRAAKRM
AESTGLPASTIHRMLGINAHDDKLPEDIQELEGALLIVDETSMVDTLIMDLLLNSIPSHM
QVIFVGDRNQLPSVQPGQVFSDLLVSDTLPKKELTKIYRQGKGSSIINLAHSIKNGELPA
DFTKAQSDRAFIPCEAGQLTSAVEQVIKAALNKGNSKDDIQVLAPMYRGNAGINRLNTIL
QELLNPAKPRQKEVTFNEQIFRIGDRVFHLVNDPENNVFNGDIGKIVGINIPRTKKDKKG
EQIIADFDGNEVTFDKKDWINLTLAYCMSIHKSQGSEFPIVVLAMLPQYQRMFARNLLYT
GITRAKQKLVLLGNVSSFRQSAEIISLNRKTGLLKRIRMEFGVEEKPVEKTDNEEVAVNN
NKEQDLHC
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggctggaaggatttataataattatacaaatagtaccttggaaataatccatgaagat
ccatacaggttatccgtagatattgacggaattagctttactaaagcagatcaaatagca
cagcaatttggttttgctagtgattcccctggtagaattcgaggagctatttttcaatca
ttatatgatttgacttatgctacaggaaatacttatgttgagttaaaacctttagtaact
gaaacattaaaacttcttgaaagtaatcgcaatgaagcaatcgacccacaattagttgca
gatcagttaattaagcttgctgaagaagataaaattaagtctgatgataataaagtgtac
agtagaacctttttcaatgccgagtggaatatagcagagaatttatatcgactattgaaa
tcgggtaacagtgatttaccaaataatgatgcattattagataaactcttaataaaagct
gaggatcaattggaaatagattatgatagtgaacaaaaaagggcgataaaagatgcaatt
aaatcgccagtttttctgttaacaggtggtccaggtactggtaagacaacaattattaat
gggattgttgcagtatatgccttattaaacgacatagatttagatattggtaagtatgat
aaagataatccatttccaatattgttagctgcaccaacgggacgagctgctaaaagaatg
gcagaatcgacgggattaccagcttctacaattcatagaatgttaggaataaatgcacat
gatgataagttacctgaagatattcaagaacttgaaggtgcattgttaattgtcgatgaa
acatctatggtagatacacttatcatggatttattgttaaatagtattcctagtcatatg
caagttatttttgtgggagatagaaatcagctcccatcagtacaaccagggcaagtattt
tctgatttattagttagtgataccttacctaaaaaagaattaacgaaaatctatagacaa
ggtaaaggttcctcgataattaatttggcacattcaataaagaatggagagctaccagca
gactttactaaagcacaatctgacagagcatttattccatgtgaagctgggcaattaact
tctgctgttgagcaagtgataaaagctgctttgaataagggaaatagtaaagatgatatt
caagtattagctccaatgtatcgtggtaatgcaggaattaataggttaaatactatttta
caagaattattgaatccagctaaacctcgacaaaaagaagttactttcaatgagcaaata
tttagaattggggatagagtttttcatttagtgaatgatcctgaaaataatgtctttaat
ggtgatattgggaagattgtgggaataaatatacctagaactaaaaaagataaaaagggt
gaacagataatagcagatttcgatggaaatgaggtaacttttgataaaaaggattggatt
aatttgacgttggcttattgtatgtccatccataaatcccaaggtagtgagtttccaatt
gtagtgttggcaatgttaccacaatatcaaagaatgtttgctagaaatttgttatataca
ggaataactagagctaagcaaaaattagttcttttagggaatgtttcttcatttagacaa
agtgcagagattatctctctcaatagaaaaactggattattgaaacgtataagaatggaa
ttcggagtagaagaaaaaccagtagaaaaaactgataatgaagaagttgctgttaataat
aacaaagaacaagatcttcattgttga

DBGET integrated database retrieval system