KEGG   Lactobacillus salivarius CECT 5713: HN6_00928Help
Entry
HN6_00928         CDS       T01962                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase subunit RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lsi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1155187..1155792)
Genome map
AA seq 201 aa AA seqDB search
MYEYLRGVITEVTPYYIVVDVNGVGYQVYVANPFKYEEDEHVEQKVFVYQAVRDNDISLY
GFKNSSEKQLFLKLLDVSGIGPKSALAILANDDNRGLINAINSDDDGYLTKFPGIGKKTA
KQIILDLKGKLSDVDSDMLTGQDNLDLDLNASSPYLKESLEALRALGYTKTEVKRISKKL
EKYDGKSTDDYLRQGLRLLMS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaatatttaagaggtgtaataaccgaagtaacaccgtactatattgtagttgat
gtaaatggagtaggatatcaagtttatgttgctaatcctttcaaatatgaggaagatgag
catgtagaacaaaaagtttttgtttatcaagcagttagagataatgatataagcttatat
gggtttaaaaatagttcagagaaacaattatttttaaaacttttagatgtatctggaatc
ggtcctaagagtgcattggcgattctagctaatgatgataatcgtggtttgattaatgca
attaacagcgatgatgatggatatttgacgaagtttccaggtatcggtaaaaagactgct
aaacaaattattttggatttgaaaggtaagttatcagatgttgatagtgatatgttaact
ggacaagataatttagatttagatttaaatgcttcttcaccatatttgaaagaaagtttg
gaagcattacgtgctttgggatatactaaaacagaagttaaaagaattagtaagaaactt
gaaaaatatgacggtaagtcaacagatgattatctacgacaaggtttacgtttattaatg
agttaa

DBGET integrated database retrieval system