KEGG   Lactobacillus salivarius CECT 5713: HN6_00964Help
Entry
HN6_00964         CDS       T01962                                 

Gene name
tpiA
Definition
(RefSeq) Triosephosphate isomerase (TIM) (Triose-phosphate isomerase) (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HN6_00964 (tpiA)
   01230 Biosynthesis of amino acids
    HN6_00964 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HN6_00964 (tpiA)
   00051 Fructose and mannose metabolism
    HN6_00964 (tpiA)
   00562 Inositol phosphate metabolism
    HN6_00964 (tpiA)
Enzymes [BR:lsi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HN6_00964 (tpiA)
Exosome [BR:lsi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HN6_00964 (tpiA)
  Exosomal proteins of bladder cancer cells
   HN6_00964 (tpiA)
  Exosomal proteins of melanoma cells
   HN6_00964 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1199060..1199815)
Genome map
AA seq 251 aa AA seqDB search
MRTPIIAGNWKMNMNPEQTAEFVKAVKDNLPAASEVEAVIAAPAVDLPALLENAKGSDLK
VAAENCYFEDEGAFTGETSPKVLKEMGVDYVVIGHSERRDYFHETDEDINKKAHAIFRNG
LTPIICCGESLETREAGKAEEWVANQVTAALKDLSAEQVASLVIAYEPIWAIGTGKTATA
DQAEEICAVVRKTVADLYDETVADKVRVQYGGSVKPANVKELMAKENIDGGLVGGASLVP
DSYLQLVNYKN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtacaccaattatcgcaggtaactggaaaatgaatatgaatccagaacaaactgca
gaatttgtaaaagctgttaaggataatttaccagcagcatctgaagttgaagctgttatt
gcagctcctgctgttgacttaccggcattacttgaaaatgcaaaaggttctgatttaaaa
gttgcagctgaaaactgctactttgaagatgaaggtgcttttacaggtgaaacatcacca
aaagtactaaaggaaatgggagtagactacgttgttatcggtcattccgaacgtcgtgat
tacttccacgaaactgatgaagatattaacaagaaagctcacgctatcttccgtaatggt
ttaacaccaatcatttgctgtggtgaatctttggaaactcgtgaagctggaaaagctgaa
gaatgggtagcaaatcaagttacagcagctttgaaggatctttccgcagaacaagttgca
agcttagttatcgcttatgaaccaatctgggctatcggtacaggtaagacagctactgca
gatcaagcagaagaaatttgtgcagtagttcgtaagacagttgctgatttatatgatgaa
acagtagctgacaaagtacgtgtacaatacggtggttctgtaaaaccagctaacgttaaa
gaattaatggcaaaagaaaacattgatggtggattagttggtggagcttcattagttcct
gattcatacttacaattagtaaactacaaaaactag

DBGET integrated database retrieval system