KEGG   Lactobacillus salivarius CECT 5713: HN6_01012Help
Entry
HN6_01012         CDS       T01962                                 

Gene name
recR
Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lsi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1260229..1260828)
Genome map
AA seq 199 aa AA seqDB search
MQYPEPISKLIDSYMKLPGIGSKTATRLAFYTIDMQEDDVTEFAQSLISAKRDLSYCSIC
GNITESDPCMICADKSRDNSKVVVVEQPKDVMSLERMNEYHGLYHVLHGVLSPIEGKGPE
DINIASLLRRLQKNEAIKEVIIATNATPEGEATAMYIARLVKPANIKVTRLAHGLAVGSD
IEYADEMTLFKAIEGRQEI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatccagaacctatttctaaattaattgatagttatatgaaattaccaggaatt
ggtagtaaaacggcaactagattagcattctatacaattgatatgcaagaggatgatgta
accgaatttgctcaatctttgatctctgctaaaagagatttaagttattgcagtatctgt
ggcaatattactgaaagtgatccttgcatgatttgtgctgataaatcgcgagacaatagt
aaggttgttgttgttgaacaacccaaggatgtaatgtcattagaaagaatgaatgagtat
catggtttatatcatgtacttcatggtgtattatctccaattgaaggaaaaggtcctgaa
gatataaatatcgcttctcttttaagaagactgcagaaaaatgaagcaataaaggaagtt
atcattgctactaatgcaacccccgaaggagaagcaactgctatgtatattgctcgttta
gtaaaaccagctaatataaaagttactagattagcacatggattagctgtaggtagtgat
attgaatatgcagatgagatgacattatttaaagctattgaaggacgacaagaaatttaa

DBGET integrated database retrieval system