KEGG   Lactobacillus salivarius CECT 5713: HN6_01025Help
Entry
HN6_01025         CDS       T01962                                 

Gene name
glnS
Definition
Glutamyl-tRNA synthetase (Glutamate--tRNA ligase) (GluRS) (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:lsi00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    HN6_01025 (glnS)
Enzymes [BR:lsi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     HN6_01025 (glnS)
Amino acid related enzymes [BR:lsi01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   HN6_01025 (glnS)
Transfer RNA biogenesis [BR:lsi03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    HN6_01025 (glnS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1278362..1279849)
Genome map
AA seq 495 aa AA seqDB search
MAKNKIRVRYAPSPTGHLHIGNARTALFNYLFARHNKGTFVLRIEDTDTKRNIADGEKSQ
MDNLEWLGIDWDEGPDKPGKYGPYRQSERKDIYKPLIQELLDKDLAYESFMTEEELQAQR
EEQKARGEAPRYVYEYEGMSKEEIKKAQDEARAKGLKPVVRIRVPHNKTYEWDDIVKGKI
SFLSDTIGGDFVIQKRDGMPTYNFAVVVDDHLMEITHVLRGDDHVANTPKQLVVYEAFGW
KAPEFGHMSLIINTETGKKLSKRDETVLQFIEQYRELGYLPDAMFNFITLLGWSPVGESE
IFNKQEFIKMFDAKRLSKSPAAFDGKKLEWINNQYVKAAKEDEIMDSSLRQLIKAGKVQA
DPDAYTIEWARKLISLYKQQMSYTGQIVEMADVFFNEPPVLSEDAKKELADESAAIVLKE
FAERVKDLPIFDAVEIQNTIRSIQKDTKIKGRKLYMPIRIATTREMHGPELAPSIELLGR
EKALKHLKQTLEEMN
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaaaacaagatacgtgtacgttatgctccaagtccaactggacatttgcatata
ggtaacgcaagaacagctttatttaactatttatttgcaagacataataagggaactttt
gtattaagaatcgaagatactgatacaaagcgtaatattgcagatggtgaaaagagccaa
atggataacttggagtggcttggtattgactgggatgaaggtcctgataagccaggtaag
tacggaccatatcgtcaatctgaaagaaaagatatctacaagccattaattcaagaatta
ttagataaagatttagcttatgaatcattcatgacagaggaagaattacaagctcaacgt
gaagaacaaaaagctagaggagaagctcctcgctatgtctatgaatatgaaggcatgtct
aaagaagaaatcaagaaggctcaagatgaagcacgtgctaagggattaaaaccagttgtt
cgtattcgtgtgccacacaacaagacatacgaatgggatgacattgtaaagggaaagatt
agcttcttatctgacacaattggtggagatttcgttattcaaaaacgtgatggtatgcct
acatataactttgctgttgtggtagacgatcatttaatggaaattactcatgtattacgt
ggggatgatcatgttgctaatacaccaaagcaattagttgtatatgaagcatttggttgg
aaagcacctgaatttggtcatatgtccttaattattaatactgaaactggtaagaagtta
agtaaacgtgacgaaacagtgcttcaatttatagaacaatatcgtgaactaggttactta
cctgatgcaatgtttaactttattactttattaggttggtctcctgttggcgaatcagaa
atctttaataaacaagaattcatcaagatgtttgatgcaaaacgtttgagcaaatctcca
gcagcatttgatggcaagaaattagaatggattaataaccaatatgtaaaggctgctaaa
gaagatgaaattatggattcttcattacgtcaattaattaaggctggtaaagtacaagct
gatccagatgcttatacaattgaatgggctagaaagctaattagtctttacaaacaacaa
atgtcttatacaggacaaattgtagaaatggcagatgtattctttaatgaaccacctgtt
ttaagtgaagatgctaaaaaggaattagctgatgaatcagcagcaattgtattaaaagaa
tttgctgaacgtgttaaagatttaccaatctttgatgctgttgaaattcaaaatacaatt
cgttctattcaaaaggatacaaagattaagggacgtaaactctacatgcctatccgtatc
gcaacaacacgcgaaatgcatggtccagaattggcaccatcaatcgaattattaggtcgt
gaaaaggcattgaaacatctaaagcaaactttagaagaaatgaactaa

DBGET integrated database retrieval system