KEGG   Lactobacillus salivarius CECT 5713: HN6_01031Help
Entry
HN6_01031         CDS       T01962                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HN6_01031 (gpmA)
   01230 Biosynthesis of amino acids
    HN6_01031 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HN6_01031 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    HN6_01031 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HN6_01031 (gpmA)
Enzymes [BR:lsi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HN6_01031 (gpmA)
Exosome [BR:lsi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HN6_01031 (gpmA)
  Exosomal proteins of melanoma cells
   HN6_01031 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1285633..1286307)
Genome map
AA seq 224 aa AA seqDB search
MVKLVLLRHGESTANEANIYTGWSDVPLTIKGCEQAKVAGKKLKEENITFTKAHTSLLER
AIKTEMIVLDEINQSWIPLEKTWRLNERHYGALRGLNKEFTKHKYGKHQVALWRRSFDTV
PPMLDERIEEPKYKKYPSTIIPRAESLKDAYNRILPYWVDEIAPELLHGNNQIVIAHGST
LRAMIKYIENISDEGIDGVEVANAEPIIYELDNKLRVISKKILK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
ttggttaagcttgtattgcttagacatggggaaagtacggctaatgaggcaaatatttat
actggttggtcagatgttccattgacaattaaaggttgtgaacaagctaaagttgcaggg
aaaaaattaaaagaagaaaatattacctttactaaagctcatacttctttgttagagagg
gctataaaaacggaaatgattgtattagacgaaatcaatcagtcatggataccacttgaa
aagacttggagattaaatgaacgtcattatggagcattgagaggattaaataaagaattt
acaaagcataaatatgggaaacaccaagttgctttatggagacgatcgtttgatactgtt
cctcctatgttggatgaaaggatagaagaacctaaatataagaaatatccttctacaatt
attccgcgtgcagaaagtttaaaggatgcttataatcgaatactaccatattgggttgat
gagatagcacctgaattattacatggaaataaccaaattgtgattgctcatggaagtacg
ttaagggcaatgattaaatatattgaaaatattagcgatgaaggaattgatggtgtagaa
gttgctaatgctgaaccgattatttatgaattagataataaacttcgagtaatctcaaag
aaaatattaaaataa

DBGET integrated database retrieval system