KEGG   Lactobacillus salivarius CECT 5713: HN6_01064Help
Entry
HN6_01064         CDS       T01962                                 

Gene name
galM
Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
lsi00010  Glycolysis / Gluconeogenesis
lsi00052  Galactose metabolism
lsi01100  Metabolic pathways
lsi01110  Biosynthesis of secondary metabolites
lsi01120  Microbial metabolism in diverse environments
lsi01130  Biosynthesis of antibiotics
Module
lsi_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:lsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HN6_01064 (galM)
   00052 Galactose metabolism
    HN6_01064 (galM)
Enzymes [BR:lsi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     HN6_01064 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADJ79329
Position
complement(1321014..1322006)
Genome map
AA seq 330 aa AA seqDB search
MIEEEHFGYIGNKEISKYILKNKQQTRVGILNLAGIIQEFSIVVNSKQKNLVVNFDTPNE
YVENNFQICKQIGRVAGRIKGASFELDNMQYTVEANEGSNALHGGSHGLSTQILDAKITG
NTLILFTRLKHEVDGYPGDIDLEISYSLDDDNCLSVGYKAKAIGSTVFDPTVHVYWRLPQ
GLKNSKLIIPTGQHVETDVENIPTGNFDTNEKYNLQKEKYLSNVIEELRSDEIAGLDDIY
KVDASDDKVVARLTNMEDNINIDIFSNRNGLIVFTADPIDVANHDKGIYNAVATEAQTVS
DSLHHPDFGDIRLYDGQEKNYEIKYKVSIV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagaagaacattttggatatattggaaataaagaaatttcaaaatatattcta
aaaaataagcaacaaacacgagttggaattttaaatttggcaggaataattcaagaattc
tcaatagtagtaaattctaagcagaaaaatttggttgttaattttgacacacctaatgag
tatgtagaaaataactttcaaatttgtaagcaaataggaagagttgctggaagaataaaa
ggtgcaagttttgaacttgataatatgcaatatacagtagaagctaatgaaggttctaat
gcattgcatggaggctcacatggtttaagcacccaaatcttggatgccaaaattacagga
aacactttaatcttatttacgagattaaaacatgaagtagatggttatccaggagatata
gacttggaaataagttatagtttggatgatgataattgcttgagtgtgggatataaggct
aaagcaattggaagtacagtttttgatccaacggtgcatgtctattggagattaccacaa
gggttgaagaattccaagttgataattcctactggtcaacatgtagaaacagatgtggaa
aatattccaactggtaattttgatacgaatgagaagtataatttacaaaaagaaaaatat
ttatcaaatgtaatagaagaactaagatctgatgaaattgcaggtttagacgatatctat
aaagttgatgctagtgacgataaagtggttgctagacttaccaatatggaagataatatt
aatatagatatttttagtaatagaaatggactgattgtttttacagctgatcctatagat
gtagctaatcatgacaagggtatttacaatgcagtggcaactgaagctcaaacagtttct
gattcgttgcatcatccagattttggtgatataaggttgtatgatggtcaggaaaaaaat
tacgaaataaaatataaagtaagtatagtttga

DBGET integrated database retrieval system