KEGG   Lactobacillus salivarius CECT 5713: HN6_01076Help
Entry
HN6_01076         CDS       T01962                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching enzyme (Glycogen-branching enzyme) (BE) (1,4-alpha-D-glucan:1,4-alpha-D-glucan 6-glucosyl-transferase) (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lsi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1338490..1340439)
Genome map
AA seq 649 aa AA seqDB search
MAVNTEERHGQESLENHKHMFNQGVNYELYNFLGVHKISRDDENGYVFRVWAPHAKQVWV
CGDFNNWDKSHPMILDEKSGIWSIEVKESRENQYYKYLVKQANGREIMKTDPMAQVYEKR
PETAAVVKELEPFKWNDGLWRGRQKRMNHFNNPINIYEVHAPSWKEHEDGSLYTFKDLTA
ELIPYVKKMGYTHIEFMPLMEHPLPASWGYQLTGYFALCSSYGTPDEFKDFVNECHQNNI
GVLVDWVPGHFSINDDALAYYDGTPTYEYEDPDRAKNIGWGALNFDLGKPEVQSFLLSSA
FYWLNEFHLDGMRVDAVSNMIYLDYDEGPWKPNKYGDTRNLEGYAFLQKFNKVVKFAHPE
SLIIAEESSSGTQISGTIESGAIGFDYKWNMGWMNDVLEFFEMDPYFRKDNLNLVTFSFM
YWQAENFVLPLSHDEVVHGKKSLMHKMWGDRYRQFAQLRTLYTFMIMHPGKKLLFMGGEW
GQFLEWKFDHGLEWVDLQDEMNAKMQHFTSVLNHFYKEERPLWELGQQDATLEVIDADNH
NDTVLSFIRHGKRKKDFLIVILNFTPVERRNFRIGVPYEGTYTEILNTEMKEFGGTWVEH
NADSVSEEVNFKDYEHSITTTVPALGAIILKPKDIKVTRRSSKKHSHKK
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaatacagaagaacgccacggacaagaatcgctagaaaatcataaacacatg
tttaatcaaggtgtgaactatgaactctataattttttaggtgttcataaaattagtaga
gatgatgaaaacggttatgtttttcgcgtttgggctcctcatgctaaacaagtatgggta
tgtggagactttaacaattgggataaatctcatccgatgattttagatgagaaatctggt
atttggagtatcgaggtaaaagaatctagagaaaatcaatattataaatatctagtcaaa
caagcaaacggtagagaaattatgaagacagatcctatggcacaggtatatgagaaaaga
cctgagacagcagctgtcgtcaaagaattggaaccgtttaaatggaatgacggtctatgg
cgtggcagacaaaaacgtatgaatcattttaataatcctatcaatatttatgaagtacat
gcaccatcatggaaagaacatgaagatggtagtttgtatacgtttaaggatttaacagca
gagttaataccatacgtgaagaagatgggttacactcatatcgaatttatgccattgatg
gagcatccccttccagcatcctggggttatcagttaacggggtactttgctttgtgttca
agttacggtacaccagatgagtttaaggattttgttaatgaatgccatcaaaataatatt
ggtgttttggttgactgggttcctggtcacttcagtattaatgatgatgctttagcatat
tatgatggaactccaacttacgagtatgaagatccagacagagctaagaatataggttgg
ggagctttgaattttgatttaggtaaaccagaagtgcaatcattccttttatcaagtgcc
ttttattggcttaacgaatttcatttagacggtatgcgagtagatgccgtatcaaacatg
atttacctagattatgatgaaggcccatggaaacctaataaatacggagatactcgtaat
ttagaaggatatgctttcctacaaaaattcaataaagttgtgaagttcgctcatcctgaa
tctttgattattgctgaagaaagttcatcaggtacacaaatatcaggaactattgaatct
ggagcaataggatttgattataaatggaatatgggttggatgaatgatgtattagaattt
ttcgaaatggatccatattttagaaaagataacttgaatttagttacattttcatttatg
tactggcaagcagaaaactttgtattacctttatcacatgatgaagtggtacatggtaag
aagagtttaatgcataagatgtggggagacagatatcgtcaatttgcacaattgagaaca
ctttatacatttatgattatgcatccaggtaagaaattacttttcatgggtggcgaatgg
ggacaattcttagaatggaaatttgatcacggattagagtgggtagatttacaagatgaa
atgaatgctaagatgcaacatttcacttcagttttaaaccacttctacaaggaagaaaga
ccattgtgggaattgggtcaacaagatgctacgttagaagttatagatgctgataatcat
aatgatacagttttaagctttattcgtcatggtaaacgtaaaaaagatttcttgattgtt
atcttaaactttacaccagttgaaagaagaaacttcagaattggtgtcccatatgagggt
acatatactgaaattttaaatactgagatgaaggaatttggtggaacatgggtagagcat
aatgctgatagtgttagcgaagaagttaactttaaagattatgaacattctattactaca
acagttccagctttaggcgcaattatattgaaacctaaagatattaaggtaactcgtcga
agttctaagaaacactcacataagaaataa

DBGET integrated database retrieval system