KEGG   Lactobacillus salivarius CECT 5713: HN6_01223Help
Entry
HN6_01223         CDS       T01962                                 

Definition
(GenBank) Succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
lsi00300  Lysine biosynthesis
lsi01100  Metabolic pathways
lsi01120  Microbial metabolism in diverse environments
lsi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lsi00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    HN6_01223
Enzymes [BR:lsi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HN6_01223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Osteoregulin Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: ADJ79476
Position
complement(1528523..1529659)
Genome map
AA seq 378 aa AA seqDB search
MNEMDKIKVLADIVEIPSVNDDEVSVAKYIRDLFAKYGIESKILKVKGNRANLVAEIGEK
GPILGFSGHLDVVAAKESDGWHSDPFKLVERDGKLYGRGTSDMKSGVAAMIVSLIELQQK
GLKNGRIRLMLTMGEEIGEEGSAYFYEHGYMKDVSALVISEPTYYRIIYAEKGSLDLKIT
SRGKAAHSSMPNLGYNAVNPLIELLSELNEFFSNPPKNDVLGPLTFNVTVFKGGEQVNTI
PDYAEAEINVRTLPNFDGNDVIKKLDEYLEKKNENGATLTREVLMNEDAVLKSPDSVIAD
LAAEIVESRGREVVKTIAPGITDASNLLKEKKEDYPFIVFGPGNPLVSHQVDEYVEKKAY
LDFIDIYQELAEKYFIND
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaatggataaaatcaaagtattagcagatattgttgaaatcccatcagtaaac
gatgatgaagtgagtgtagctaaatatataagggatttatttgcaaaatatggaatcgaa
tctaaaattttaaaagttaaaggaaacagggccaatttagttgcagaaataggagaaaaa
ggtcccattctaggattctcagggcatttagatgtagttgcagctaaggaaagtgatggt
tggcatagtgatccatttaaattagttgaaagagatgggaaactttatggtcgcggaaca
tcagatatgaagtctggggtagcagcgatgatcgtttctttaattgaattgcagcaaaaa
ggattaaaaaacggaagaattcgcttgatgctgacaatgggtgaagaaataggggaagaa
ggatcagcatatttttacgaacatggctatatgaaagatgtttctgccttagtgattagt
gaacctacgtattacagaataatttatgcggaaaaaggttcattagatttgaagattact
tctagaggtaaagctgcacatagttcaatgccaaatcttgggtataatgctgtaaatcca
ctaattgaattacttagtgaattaaatgaatttttcagtaatccaccaaaaaatgatgta
ttagggccacttacattcaatgtgacagtctttaaaggtggagaacaagtaaatacaatt
cctgattacgctgaagcggaaattaatgttcggacattacctaattttgacggaaatgat
gtaattaagaagttagatgaatatcttgaaaagaaaaatgaaaatggcgctacattaacg
agagaagttttaatgaatgaagatgcagtactaaaatcaccagattcagtaattgctgat
ttagctgctgaaattgttgaaagccgtggaagagaagtcgttaagaccattgcaccaggt
attacggatgcttctaatttactaaaggaaaagaaagaagattatccatttatagtattt
ggtccaggtaatccattggtaagtcatcaagtagatgaatatgtggaaaagaaagcttat
ctagattttattgatatttatcaagagttagctgaaaaatattttattaatgattag

DBGET integrated database retrieval system