KEGG   Lactobacillus salivarius CECT 5713: HN6_01245Help
Entry
HN6_01245         CDS       T01962                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
lsi00010  Glycolysis / Gluconeogenesis
lsi00260  Glycine, serine and threonine metabolism
lsi00680  Methane metabolism
lsi01100  Metabolic pathways
lsi01110  Biosynthesis of secondary metabolites
lsi01120  Microbial metabolism in diverse environments
lsi01130  Biosynthesis of antibiotics
lsi01200  Carbon metabolism
lsi01230  Biosynthesis of amino acids
Module
lsi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lsi_M00002  Glycolysis, core module involving three-carbon compounds
lsi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HN6_01245 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    HN6_01245 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HN6_01245 (gpmA)
Enzymes [BR:lsi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HN6_01245 (gpmA)
Membrane trafficking [BR:lsi04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    HN6_01245 (gpmA)
Exosome [BR:lsi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HN6_01245 (gpmA)
  Exosomal proteins of melanoma cells
   HN6_01245 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADJ79498
Position
complement(1554559..1555245)
Genome map
AA seq 228 aa AA seqDB search
MPKLVFIRHGQSEWNLKNLFTGWEDVNLSEKGVEEAKEAGRKLKEAGIEFDQAYTSVLTR
AIKTLHFALEESGQLWIPEMKTWRLNERHYGALQGKNKADAAEKYGDEQVHIWRRSYDVL
PPLLSADDEGSAANDRRYADLDPRIIPGGENLKVTLERVIPFWEDHIAPDLLAGKNVIVA
AHGNSLRALTKYIEQISDEDIMNVEMATGQPVVYDLDDKLNIVNKEKL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattagtatttatccgtcacggacaaagtgaatggaacttaaagaaccttttc
acaggttgggaagacgttaacttgagtgaaaaaggtgttgaagaagctaaggaagcaggt
cgtaagttaaaagaagctggtatcgaatttgaccaagcttacacatctgttttaactcgt
gctatcaagactttacactttgctttggaagaatctggccaattatggattccagaaatg
aagacatggcgtttaaacgaacgtcactacggtgcattacaaggtaagaacaaagcagac
gctgctgaaaagtatggtgacgaacaagttcacatctggcgtcgttcttacgatgtatta
cctccattattgagtgcagatgatgaaggttctgcagcaaacgatcgtcgttatgctgac
ttagacccacgcatcattcctggtggcgaaaacttgaaagttactttggaacgtgtaatt
cctttctgggaagaccacattgcaccagacttattggctggtaagaacgtaatcgttgct
gcacacggtaactcattacgtgctttaactaagtacatcgaacaaatctctgatgaagac
atcatgaacgttgaaatggcaacaggtcaaccagttgtttacgacttggatgacaagtta
aacattgtaaacaaagaaaagctttaa

DBGET integrated database retrieval system