KEGG   Lactobacillus salivarius CECT 5713: HN6_01268Help
Entry
HN6_01268         CDS       T01962                                 

Gene name
thrC
Definition
(RefSeq) Threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lsi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HN6_01268 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HN6_01268 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HN6_01268 (thrC)
Enzymes [BR:lsi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HN6_01268 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
1584478..1585965
Genome map
AA seq 495 aa AA seqDB search
MATLYRSTRDASANSISSSQAVLQGISPDGGLFVPVDFPKLDLDLSQLPSLSYQELAYKI
LQPFFSDFTEDELRSCINSAYGSNFTSEEITPVSYHAGNIYLELFHGPTIAFKDVALQLL
PYLLITSAKKNNSNLKNVILTATSGDTGKAAMAGFADVENTQIIVFYPKYGVSPIQEKQM
LTQTGKNVYVVGITGNFDNAQTNVKQIFNNSTLTDELLKSGYQFSSANSINIGRLLPQIV
YYFYAYGQLLADNKIKLGDNVNFSVPTGNFGDILAGFFAKKLGLPINKLLCASNENNILT
EFFKTGTYNKKRDFKVTNSPSMDILVSSNLERLLFYATNGNAALVAEWMNQLEKEGEYTV
DSDTLKFLQTHFYASSASQTDTKNEIKQVFTESNYAIDPHTAVASFVTREYKESAADSCP
TVTVSTASPYKFPQTVLAALGVDNATGDLDDVQKLVDLIKLPLPKTVANLFEAKQLHDTV
IEPDEMENYVKELLI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcaactttgtatcgtagtacacgcgacgcttcagctaatagtatttcttcgtctcaa
gctgttcttcaaggaattagtcccgatggtggtttgtttgttccggttgattttcctaaa
ttagatttagatttatcacaattgccatcgctatcctatcaagaactagcttacaaaatt
ctccaaccttttttcagtgactttaccgaagacgaattgcgttcatgcatcaactctgct
tatggcagtaattttactagtgaagagattaccccagtttcctatcatgctggtaatatt
taccttgaactatttcatggtcctacaattgcttttaaagatgttgctctacaattatta
ccttacctattaataacatcagctaagaaaaataattctaatctgaagaacgtcatctta
actgctacttcgggcgatacaggtaaagctgccatggctggattcgcagatgtagaaaat
acgcaaattattgttttttatcctaaatacggcgttagtcctattcaagaaaaacaaatg
cttacacaaactggtaaaaatgtctatgtggttggtattactggtaatttcgataatgct
caaacaaatgttaagcaaatttttaataattcaactttaactgatgaactactaaaaagt
ggctatcaattttcatcagctaactctattaatattggtagattattaccacaaattgtt
tattacttctatgcttatggacaattattagctgataataaaatcaagttaggcgataat
gttaatttcagtgttccaactggaaactttggtgatattttagctggattcttcgctaaa
aaacttggcttacctattaataagctactatgtgcatcaaacgaaaataatatcttaact
gaatttttcaagactggtacatataataagaaacgtgatttcaaagttacaaactctcct
tcaatggatatccttgtatctagtaacttagaacgcttattattctacgctacaaatgga
aatgcagctttagtggctgaatggatgaaccaacttgaaaaagaaggcgagtatactgtt
gactcagatacacttaaattcctccaaacacatttctacgctagttcggcaagtcaaact
gatactaaaaatgagattaagcaagttttcactgagagtaattatgctattgaccctcat
accgcagttgcttcctttgttactcgagaatataaagaatcagctgctgattcttgtcca
acagttacagtatctacggcaagtccgtataaattcccacaaacagttctagctgcttta
ggagtagataacgcaactggtgatttagatgacgtacaaaaattagttgatttaattaaa
ctgcctctacctaagacggtcgccaatctatttgaagctaaacaattacatgatactgtt
attgaacctgatgagatggaaaattatgttaaagaattgctgatttaa

DBGET integrated database retrieval system