KEGG   Lactobacillus salivarius CECT 5713: HN6_01645Help
Entry
HN6_01645         CDS       T01962                                 

Definition
Alcohol dehydrogenase / Acetaldehyde dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lsi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HN6_01645
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HN6_01645
   00620 Pyruvate metabolism
    HN6_01645
   00650 Butanoate metabolism
    HN6_01645
  Lipid metabolism
   00071 Fatty acid degradation
    HN6_01645
  Amino acid metabolism
   00350 Tyrosine metabolism
    HN6_01645
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HN6_01645
   00626 Naphthalene degradation
    HN6_01645
Enzymes [BR:lsi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HN6_01645
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     HN6_01645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHN3:complement(191728..194385)
Genome map
AA seq 885 aa AA seqDB search
MVNKTNNKEEDARVYTDGLVEKALKAEQEYSTFSQEQVDKIVAAAALAGSEAALILAHEA
VDETGRGVVEDKDTKNRFATENVYNAIKNDKTVGVIEEDKIKGEVKIAAPLGVLAGIVPT
TNPTSTAMFKSLLALKTRNAIVFAFHPQAQKSSAHAAKIVYDAAVKAGAPKNIIQWIEEP
SLEKTTALIQNPKIASILATGGPGMVNAALKSGNPSMGVGAGNGAIYVDHTAHLDRAVED
LLLSKRFDNGMICATENSAVVEAPIYDEWLKKMEEKGAYVVPKKDYKKIEDFVFNDRHGV
NGPVAGKPARWIAEQAGVELPEGKDVMLFELSAKNIGEKLSSEKLSPLLSVYKAKDREDG
IKTVAALLDYQGAGHNAAIQIGSQSDPFVKEFGDRTKAARILVNQPDSIGGIGDIYTDGL
RASLTLGTGSWGKNSLSHNLSTSDLLNVKTVAKRRNRPQWVRLPEKIYYEKNAISYLQDE
TEDINRAFIVADPGMVKFGFVDKVYDQLAARENEVKISLYGTVRPDPMLGQTIEIAQQMA
QFEPDTVIAIGGGSALDATKIARYIYEYSLDQEPGFLDSYEKVSEVFKELQQKFVDIRKR
IVKFHHAKKTRMFAIPTTSGTGSEVTPYAVITDDNTHVKYPLTDYELTPQVSIVDPEFVM
TVPKRTVALSGLDSLSHALESYVSVMASDFTRPWSMQAIKLVFENLEASYNYDPKHPTLE
GEKARENMHYAATLAGMAFANAFLGINHSIAHKTGGEFGLPHGLAISIAMQHVIKFNGAS
GRVKRTPFPRYEVYRAQKDYADIARALGLKGNSDAELVDALCNKINDLMKKLDVEPKLSA
NGVTKEQFEKALDKMVDRIYDDQCTTANPRQPYLEEIRQLLIDQF
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atggttaacaagacaaacaacaaagaagaagatgctcgtgtatacactgatggtttagta
gaaaaagcattaaaagctgaacaagaatattctactttctcacaagaacaagtagataag
attgttgcagctgctgctttggctggctcagaggctgctttgattttagctcatgaagca
gtagatgaaactggacgtggggttgtagaagataaggatacaaagaaccgtttcgcaact
gaaaatgtctataatgctattaagaatgataaaacagttggtgtaattgaagaagataag
attaaaggcgaagtaaaaattgcagctccacttggtgttttagcaggtattgtacctaca
acaaacccaacatcaacagcaatgtttaagtcattattagcattgaagactagaaacgca
attgtattcgctttccacccacaagctcaaaagagttcagcacatgctgcaaagatcgtt
tatgatgcagctgtaaaagctggtgctccaaagaacattattcaatggattgaagaacca
agtctagaaaagacaacagctcttattcaaaatccaaagattgcttctattttggctact
ggtggtccaggaatggttaatgcagctttgaagtctggtaatccatcaatgggtgtaggt
gctggtaatggtgctatctacgttgatcatacagcacaccttgacagagctgttgaagat
ttacttctatctaagagatttgataacggtatgatttgtgctactgaaaactctgcagtt
gttgaagctcctatctatgatgaatggctaaagaagatggaagaaaaaggagcatacgtt
gttcctaagaaagactataagaagattgaagatttcgtattcaatgatagacatggtgta
aatggtccagttgctggtaagccagctcgctggattgctgaacaagctggtgtagaactt
ccagaaggtaaagatgtaatgttattcgaactttctgctaagaacatcggtgaaaaacta
tcatctgaaaagctttctccattattgtcagtatataaagcaaaagatcgtgaagatggt
attaagaccgttgctgcattattagattatcaaggtgcaggccataacgctgctatccaa
attggttctcaatccgatccatttgtaaaagaatttggtgatagaactaaagcagctcgt
atcttggtaaatcaacctgattccattggtggtattggtgatatttacacagatggctta
cgtgcaagtttgacacttggaacaggatcatgggggaagaattcattgtcacataattta
tcaacatcagacctattaaatgttaagacagttgctaagagacgtaacaggcctcaatgg
gttcgtttaccagaaaagatctactacgaaaagaatgctatcagctatctacaagatgaa
actgaagatattaaccgtgcattcatcgtagctgacccaggaatggttaagtttggattt
gtagacaaagtttacgatcaattagcagcaagagaaaatgaagttaaaatatctctttat
ggaactgtaagacctgacccaatgttaggacaaacaattgaaattgctcaacaaatggca
caattcgaaccagatacagttattgctatcggtggtggctccgcattggatgctacaaag
attgctcgttatatctacgaatactccttagatcaagaaccaggattcttagatagctac
gaaaaagttagtgaagtatttaaagaattacaacaaaaattcgttgatatccgtaagaga
attgttaagttccatcatgcaaagaagacaagaatgtttgcaattccaacaacatctggt
acaggttccgaagtaacaccatatgctgttattacagatgacaatacacatgttaagtat
ccattaacagactatgaattgacaccacaagtatcaatcgtagacccagaatttgttatg
actgttcctaagagaactgtagcattgtctggattggatagtttatcacatgcccttgaa
tcatatgtatcagttatggcatctgacttcacacgtccatggtcaatgcaagctatcaag
ttagtatttgaaaacttggaagcttcatacaactacgatccaaaacatcctacattggaa
ggtgaaaaggctcgtgaaaacatgcactatgctgcaacattagcaggtatggcatttgct
aacgcattcttaggtatcaaccactcaatcgctcataagactggtggggaatttggatta
ccacatggtttggcaatttccatcgctatgcaacatgtaattaaatttaacggtgcttct
ggtcgtgtaaagcgtacaccattcccacgttatgaagtatatcgtgctcaaaaagattat
gcagatattgctcgtgcattaggcttgaaaggcaactcagatgctgaattagtagatgca
ttatgcaacaagattaacgatttaatgaagaagttagacgttgaacctaagttatctgca
aatggtgtaactaaagaacaatttgaaaaagctcttgataagatggttgatcgtatttac
gatgatcaatgcacaactgcaaatcctcgtcaaccatacttggaagaaattcgtcaattg
ttgatcgatcaattctaa

DBGET integrated database retrieval system