KEGG   Lactobacillus salivarius CECT 5713: HN6_01646Help
Entry
HN6_01646         CDS       T01962                                 

Definition
Fructose-1,6-bisphosphatase class 3 (FBPase class 3) (D-fructose-1,6-bisphosphate 1-phosphohydrolase class 3) (EC:3.1.3.11)
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HN6_01646
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HN6_01646
   00030 Pentose phosphate pathway
    HN6_01646
   00051 Fructose and mannose metabolism
    HN6_01646
  Energy metabolism
   00680 Methane metabolism
    HN6_01646
Enzymes [BR:lsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     HN6_01646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHN3:complement(195490..197460)
Genome map
AA seq 656 aa AA seqDB search
MNFDDNEELVNKQVDMNAYSHNLLKEKYPTKQDVITEIMNLEAILHLPKGTEHFVSDLHG
EYTAFDHVLRNGSGSIKQKIQDYFSDRMTEQTMQDFALLIYYPEDELALVKKKLRTENEL
QQWYLDNISHLLEFLELSGSKYTRSKVRKALNPNFVYITEELLYNDPQEFNKRSYINQLL
KNILKLDQAGKFIIATCYTIQRLVVDHLHVLGDVYDRGEEPDKIMDRLMNYHSVDMQWGN
HDLLWLGAMAGSKLCMLNLLRICARYNNLNIIEDAYGINLRHLSRFAEEQYEDNPQFRPK
LTNGDGYRFNGEKLQITQIHQAVAMMQFKLEGKVIARRPELEMDDRDLLNKIDYKKNVIS
LNGKEYPLQNTCFNTVDPKNPSELTDEENAIVDELLISIQHSTKLKRHLDFMMNKGSMYR
TYNGNLLFHGCIPADEEGNFCSLKIGSKEYSGKKLFDFSEKMIRKAYSNPNVKDDFATDF
MWYLWQGALSPLFGKKSMTTFERYFIADKACHEEVKNPYYKLRENKDFCIKILQEFGFTG
DDTNHIINGHTPVKRGHNAICAEGYMLVIDGGYSKAYQPTTGIAGYTLLYNSYGLQLVSH
QPFTSKQDAIRSGKDIVSTVRVVKHELQRKSVADTDIGENIKEKIRVLYNLLRNYD
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgatgataatgaagaattagtaaataagcaagttgacatgaatgcttattcg
cataacttattaaaagaaaaatatcctacgaaacaagatgtgattaccgaaattatgaac
ttggaagcaattttgcatcttccaaagggaactgaacactttgtaagtgatttgcatggg
gagtatacagcatttgatcacgttttaagaaatggttctgggagtattaaacagaaaatt
caagattacttttcagatagaatgacagaacaaacgatgcaagattttgctttgctaatc
tactatcctgaagatgaattggctctagtaaagaaaaaattacgtacagaaaatgagcta
caacaatggtacttagataacatttcccacttattagaatttttagaattatcaggaagc
aagtatacgcgctcaaaggttcgtaaagcactaaatcctaattttgtatacataacagaa
gaattattatataacgatccacaagaatttaataagagaagttatattaatcaacttttg
aagaatattttgaaattagatcaagcaggtaaatttattattgctacctgttacacaatt
caaagattagtagtagatcacttacatgttctgggcgatgtttacgataggggagaagaa
ccagacaaaattatggatagattgatgaattatcattctgtcgatatgcaatggggaaat
catgatttactatggctaggtgcaatggcaggctcaaaactatgtatgttgaatttattg
agaatttgtgcaagatataataacttgaacatcatagaagatgcttatgggattaactta
cgtcacctttcgagatttgctgaggagcaatatgaggataatcctcaatttagacctaaa
ttgactaatggtgatgggtatagattcaacggcgaaaagctacaaatcacgcaaattcat
caagctgttgcgatgatgcaatttaagcttgaagggaaagttatagctagaagaccagaa
ttggaaatggatgatcgagatttacttaataagatagattacaagaaaaatgtaattagt
ttaaatggtaaagaatatccgttacaaaatacttgtttcaacactgtagaccctaaaaat
cctagtgaattaacagatgaagaaaatgcgattgtagatgaattattaatttccattcaa
cattctacaaaattaaaacgtcatctagattttatgatgaataaaggtagtatgtaccgt
acatataatggcaatctcttattccatggatgtattcctgcagatgaagaaggaaatttc
tgtagcttgaagattggtagtaaagaatattctggcaaaaaattgtttgatttttctgaa
aaaatgattcgaaaagcttactctaatccaaatgtaaaagatgattttgccactgatttt
atgtggtatttatggcaaggagctctttccccactgttcggtaagaaatctatgactact
tttgaacgttattttattgcagataaagcttgtcatgaagaagtaaagaatccatattat
aaattaagggaaaataaggatttctgcatcaaaattttacaagaatttggatttactggc
gatgatactaatcatattatcaatggtcacactccagttaaaaggggacataatgcaatc
tgcgcagagggttatatgttggtaattgatggaggatactccaaagcctatcagccaaca
acagggatcgctggatatacattattgtataattcatatggcttgcaactagtttcgcat
caaccatttacttcaaaacaagatgctattagaagcgggaaagatatcgtttcaacggtt
cgagtggtaaagcatgaattacaacgaaaatcagttgcggatactgatattggtgaaaat
attaaagaaaaaattagagttttgtataatttattgagaaattatgattag

DBGET integrated database retrieval system