KEGG   Lactobacillus salivarius CECT 5713: HN6_01677Help
Entry
HN6_01677         CDS       T01962                                 

Definition
Xylulose-5-phosphate/fructose-6-phosphate phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HN6_01677
Enzymes [BR:lsi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     HN6_01677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHN3:237366..239732
Genome map
AA seq 788 aa AA seqDB search
MTTNYSSKEYLELVDRYWRAADYVSVGQLYLKDNPLLDRPLVPTDVKVHPIGHWGTISGQ
NFIYAHLNRVINKYDLDMFYIEGPGHGGQVMVSNSYLDGSYTETYPEITQDKAGMQKLFK
RFSFPGGVASHADPKTPGSIHEGGELGYSLLHGAGAILDNPNLIAATVIGDGEAETGPLA
TSWQVNKFINPINDGTVLPILNLNGFKISNPTVLSRMSHEELTNYFKGLGWNPHFVEGTD
PKELHVKMADELDSIIEEIMAIRENAVKNNDESRPAWPMLVFRAPKGWGGPKEWDGDMIE
GSFRAHQIPIPVDQNHTEHLDSLVSWLKSYKPEELFDENGALLDDIKAIIPDKDHRMSSN
PVTNGGKLSKPLILPDPADFEFKTDHGTEDGSDMTELGKYIKAVFELNKDNKNFRGWGPD
ESLSNKLSAVFEETNRQWLEPIHEGSDALLAPHGRMIDSMLSEHMDEGMLEAYTLTGRHG
FFASYESFLRVVDSMLTQHFKWLRNSHEETPWREDVPSLNIISTSTAFQQDHNGYSHQDP
GIVTHLAEKKTKYIREYFPADANTLIAAFDKSLQTKQVINLIVASKHPRLQWYSAAEAKE
LVNNGLKIIDWASNVPEGEEPDVVFASAGSEPNLESLAAISILRKQAPSLKIRYVNVVDL
LKLKKDDPRGLSDAEFDAYFTKDKPVIFAFHGYVDILKDIFFDRHNHNLHLHGYKEEGDI
TTPFDMRVRNELDRFHLVKDALEVVPGVSEKYATVLQDMDLLLQKHHDYIRSEGDDIEEV
RTWKWDLD
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaattattcatcgaaagaatacttagaattagtagatagatactggcgtgca
gctgattatgtttctgtaggtcaattatatttgaaagataatcctttattggatcgtcct
ttagttccaacagatgttaaagttcatccaattggacactggggaacaatttcaggacaa
aacttcatttatgctcatttgaatcgtgtaattaataaatatgatttagatatgttctat
atcgaaggtcctggtcatggtggccaagttatggtttctaactcttatcttgatggtagt
tatacagaaacatatcctgaaattactcaagataaagctggaatgcaaaaattattcaaa
cgtttctcattccctggtggtgttgcatcacatgctgatccaaaaactcctggttcaatt
catgaaggtggggaattaggttactcactgttacatggtgcaggtgctattttagataat
cctaacttaattgctgctacagttattggtgacggtgaagctgaaacaggtcctttggca
acatcttggcaagttaataaattcattaaccctatcaatgatggtactgtattgccaatc
cttaatttaaatggtttcaagatttccaaccctactgttctttcacgtatgtcacatgaa
gaactaacaaactacttcaaaggtcttggatggaatcctcattttgttgaaggaacagat
cctaaagaattacatgtcaaaatggcagatgaattagatagcattattgaagaaattatg
gctattcgtgaaaacgctgttaagaacaatgatgaatctcgcccagcatggcctatgtta
gtattccgtgctcctaaaggctggggggggcctaaagaatgggatggagatatgattgaa
ggttcattccgtgctcaccaaattccaattcctgtagaccaaaatcatactgaacatctt
gatagtttagtaagttggctaaaatcttataaacctgaagaattatttgatgaaaatggt
gctctattagatgatattaaagctattattcctgataaagatcatagaatgtcatcaaac
cctgttactaatggtggtaaattatcaaaacctttaattttaccagatccagctgacttc
gaatttaagacagaccatggtacagaagatggctcagatatgactgaacttggtaaatat
atcaaggctgtatttgaattaaataaagataataagaatttccgcggttggggacctgat
gaatccttatctaataagttaagtgcagtatttgaagaaacaaaccgtcaatggttggaa
ccaattcatgaaggtagcgatgccctacttgctcctcatggtcgtatgattgactccatg
ttatcagaacatatggatgaaggtatgcttgaagcttatacattaactggtcgtcatgga
ttctttgcaagttatgaatcattcttacgcgttgttgattctatgttgacacaacacttc
aagtggttacgtaactcccacgaagaaactccttggagagaagatgttccatcattgaat
attatttctacttcaactgcattccaacaagatcataatggttattctcaccaagatcct
ggtattgtaactcatttagcagaaaagaagacaaaatatattcgtgaatacttccctgct
gatgctaatactttaattgcagcatttgataaatccttacaaacaaaacaagttattaac
ttaattgttgcaagtaagcaccctcgtttgcaatggtactcagcagctgaagctaaggaa
cttgttaataacggattgaagatcattgattgggcaagtaatgttcctgaaggcgaagaa
ccagatgtagtatttgcttctgcaggttctgaaccaaacttagaaagtcttgctgcaatc
tctattttaagaaagcaagcaccttctttgaagattcgctacgttaacgttgtagatctt
ttgaagttaaagaaagatgatcctagaggtctttctgatgcagaattcgatgcttacttc
actaaagataaaccagttatctttgctttccatggttatgtagacattcttaaagacatc
ttctttgacagacataaccataacttacacttacatggctataaagaagaaggagatatc
actactccattcgatatgcgtgtaagaaatgaacttgatagattccacttagttaaagat
gcacttgaagttgttcctggagttagcgaaaaatatgctacagtcttacaagacatggac
ttactacttcaaaaacatcatgactatatccgtagcgaaggtgacgatattgaggaagtt
cgcacttggaaatgggatcttgactaa

DBGET integrated database retrieval system