KEGG   Lactobacillus salivarius UCC118: LSL_0110Help
Entry
LSL_0110          CDS       T00337                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lsl  Lactobacillus salivarius UCC118
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LSL_0110 (glpK)
Enzymes [BR:lsl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LSL_0110 (glpK)
Exosome [BR:lsl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LSL_0110 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
126139..127653
Genome map
AA seq 504 aa AA seqDB search
MSDKYIMAIDEGTTSTRAIIFDKKGNKVAEGQKEFRQYFPQPGWVEHDANEIWNAVLSTI
ANSFISSGIQPKQIAGIGITNQRETTIIWDKETGLPIYNAIVWQSRQTSDIAQKLIDEGY
SDTIHEKTGLIIDAYFSATKIRWILDHVEGAQERAEKGELLFGTIDTWLTWKLTGGKVHV
TDYSNASRTMLFNIHDLKWDKEILELLNIPEALLPEVKGNSEIYGQTAAYHFFGSQVPIS
GMAGDQQSALFGQLALEDGTVKNTYGTGSFIVMNTGNKPVLSKNNLLTTIGYSIDGKINF
ALEGSVFVSGSALQWLRDSMEIIESAPESERAANESTNHNEVYVVPAFTGLGAPYWDSDA
RGAVFGLTRGTTKNDFIKATLQSLAYQTRDVLDTMEKDTGIKIPVLRVDGGAAMNNYLLQ
FQSDLLNKSVERAGNLETTALGVAFLAGLAVGFWKDTDELKELFTVGRRFEPEMSDDARE
YLYAGWKNAVEATRIFKHKINENL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtcagataaatatattatggctatcgacgaaggtactacaagtacacgtgcgattatc
ttcgacaaaaaaggaaataaagttgctgaaggacaaaaagaatttcgtcaatatttccct
caaccaggttgggtagaacatgacgctaatgaaatttggaacgcagtattatcaacaata
gctaattcttttattagctcagggatacaaccaaaacaaattgcaggtattggtattact
aaccaacgtgaaacaactattatttgggacaaagaaacaggattaccaatttataacgct
attgtttggcaatcaagacaaacaagtgatattgcacaaaaattaattgatgaaggttat
tctgatactattcatgaaaagacaggtttaatcattgatgcctacttctcagcaacaaag
attcgttggatcttagatcatgtagaaggtgctcaagaacgtgctgaaaaaggtgaattg
ttattcggtacgattgatacatggcttacatggaaattaacaggtggtaaagttcacgta
acagattattctaatgctagtcgtacaatgttgttcaacattcatgatttgaaatgggat
aaagaaattttagaattattgaatattcctgaagctttattaccagaagttaaaggaaat
tctgaaatttatggtcaaactgcagcatatcacttctttggtagtcaagttcctatttcc
ggtatggctggtgaccaacaatctgctttattcggtcaattagctttagaagatggaaca
gttaagaatacttatggtacaggttcatttatcgtgatgaatacaggtaataaaccagtt
ctttccaagaataacttactaacaactattggatattctattgatggcaagattaatttt
gctttagaaggttcagtatttgtatctggttcagcacttcaatggttaagagatagtatg
gaaattattgaatcagctcctgaatcagaaagagcagcaaatgaatcaactaaccataat
gaagtttacgttgttccagcctttacaggtttaggtgctccttactgggatagtgatgct
cgtggggcagtgttcggattgacacgtggtacaactaagaatgactttattaaagctact
ttacaatcacttgcttaccaaacaagagatgtattagatacgatggaaaaagatacaggt
attaagattccagttcttcgtgttgacggtggagctgctatgaataattacttgttacaa
ttccagtctgatttgcttaataagtcagttgaaagagctggaaacttagaaacaacagct
ttaggtgtagctttcttagctggattggcagttggtttctggaaagacacagatgaattg
aaagaattatttacagttggtcgtagatttgaaccagaaatgtccgatgatgctagagaa
tatctatatgctggatggaagaacgcagtagaagcaacacgtatattcaaacataaaata
aacgaaaatctttag

DBGET integrated database retrieval system