KEGG   Lactobacillus salivarius UCC118: LSL_0110Help
Entry
LSL_0110          CDS       T00337                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lsl  Lactobacillus salivarius UCC118
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lsl00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
126139..127653
Genome map
AA seq 504 aa AA seqDB search
MSDKYIMAIDEGTTSTRAIIFDKKGNKVAEGQKEFRQYFPQPGWVEHDANEIWNAVLSTI
ANSFISSGIQPKQIAGIGITNQRETTIIWDKETGLPIYNAIVWQSRQTSDIAQKLIDEGY
SDTIHEKTGLIIDAYFSATKIRWILDHVEGAQERAEKGELLFGTIDTWLTWKLTGGKVHV
TDYSNASRTMLFNIHDLKWDKEILELLNIPEALLPEVKGNSEIYGQTAAYHFFGSQVPIS
GMAGDQQSALFGQLALEDGTVKNTYGTGSFIVMNTGNKPVLSKNNLLTTIGYSIDGKINF
ALEGSVFVSGSALQWLRDSMEIIESAPESERAANESTNHNEVYVVPAFTGLGAPYWDSDA
RGAVFGLTRGTTKNDFIKATLQSLAYQTRDVLDTMEKDTGIKIPVLRVDGGAAMNNYLLQ
FQSDLLNKSVERAGNLETTALGVAFLAGLAVGFWKDTDELKELFTVGRRFEPEMSDDARE
YLYAGWKNAVEATRIFKHKINENL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtcagataaatatattatggctatcgacgaaggtactacaagtacacgtgcgattatc
ttcgacaaaaaaggaaataaagttgctgaaggacaaaaagaatttcgtcaatatttccct
caaccaggttgggtagaacatgacgctaatgaaatttggaacgcagtattatcaacaata
gctaattcttttattagctcagggatacaaccaaaacaaattgcaggtattggtattact
aaccaacgtgaaacaactattatttgggacaaagaaacaggattaccaatttataacgct
attgtttggcaatcaagacaaacaagtgatattgcacaaaaattaattgatgaaggttat
tctgatactattcatgaaaagacaggtttaatcattgatgcctacttctcagcaacaaag
attcgttggatcttagatcatgtagaaggtgctcaagaacgtgctgaaaaaggtgaattg
ttattcggtacgattgatacatggcttacatggaaattaacaggtggtaaagttcacgta
acagattattctaatgctagtcgtacaatgttgttcaacattcatgatttgaaatgggat
aaagaaattttagaattattgaatattcctgaagctttattaccagaagttaaaggaaat
tctgaaatttatggtcaaactgcagcatatcacttctttggtagtcaagttcctatttcc
ggtatggctggtgaccaacaatctgctttattcggtcaattagctttagaagatggaaca
gttaagaatacttatggtacaggttcatttatcgtgatgaatacaggtaataaaccagtt
ctttccaagaataacttactaacaactattggatattctattgatggcaagattaatttt
gctttagaaggttcagtatttgtatctggttcagcacttcaatggttaagagatagtatg
gaaattattgaatcagctcctgaatcagaaagagcagcaaatgaatcaactaaccataat
gaagtttacgttgttccagcctttacaggtttaggtgctccttactgggatagtgatgct
cgtggggcagtgttcggattgacacgtggtacaactaagaatgactttattaaagctact
ttacaatcacttgcttaccaaacaagagatgtattagatacgatggaaaaagatacaggt
attaagattccagttcttcgtgttgacggtggagctgctatgaataattacttgttacaa
ttccagtctgatttgcttaataagtcagttgaaagagctggaaacttagaaacaacagct
ttaggtgtagctttcttagctggattggcagttggtttctggaaagacacagatgaattg
aaagaattatttacagttggtcgtagatttgaaccagaaatgtccgatgatgctagagaa
tatctatatgctggatggaagaacgcagtagaagcaacacgtatattcaaacataaaata
aacgaaaatctttag

DBGET integrated database retrieval system