KEGG   Lactobacillus salivarius UCC118: LSL_0304Help
Entry
LSL_0304          CDS       T00337                                 

Definition
phage lysin (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
lsl  Lactobacillus salivarius UCC118
Brite
Enzymes [BR:lsl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     LSL_0304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
328274..329542
Genome map
AA seq 422 aa AA seqDB search
MKKKKILITLATCAALLFSVQLNTPSVQAARGEHGVDAAVFQGASGKWGYARDKFMISQI
GGTTTGWNLYDQWTYPTQVSSTIAQGKRAHTYIWWQNVTSNSQADYVLNYFLPKIQTPKG
SIVALDVESGYQNTQAIAHAIQRIKDAGYTPMVYGYKNYLVNNTNLSYLSTLCQLWLAEY
PNYAVTPEPNYNYFPSFNNIGIFQFTSTYVAGGLDGDIDLTGITDNGYKNGNPEKPKTHT
PAVDAGIKADNTPKRDITVGYTVKVNYSASRWATGQYMPSFIKGNSYKVIQVSGNKVLLD
GVMSWINKSDVEILQTTVQVQSNNSSYYTVKYGDTLSGIAYKYGVNVYTLARNNGISNIN
WIYPGQRLKITGNVSNQRTYTVRYGDTLSGIAYRYGVNVYTLARNNGISNINWIYPGQRL
NI
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaaaagaaaatattaattactttagcaacgtgtgcagcgttgcttttttctgtg
cagttaaacactccaagtgttcaagcagctagaggagaacatggcgttgatgcagctgtt
ttccaaggagcgagcggtaaatggggttacgccagagataaatttatgatatctcaaatc
ggtggtaccacaactggctggaacttgtacgaccaatggacttatccaacgcaagtaagt
tcaactattgcacaaggcaaaagagcacatacatatatctggtggcaaaatgtaacttca
aacagtcaagcggattatgtattaaattatttcttgccaaaaatccaaactccaaaaggt
tcaattgtggctttagacgttgaatctggttatcagaatacacaagcaattgctcatgct
atccaacgaattaaagacgctggatatacaccaatggtttatggatataagaattactta
gttaataatactaatcttagttatctatctactttgtgccaattatggcttgctgagtat
cctaattatgctgtaacaccagaaccaaattataattattttccaagtttcaataatatt
ggtatttttcaatttacttcaacttatgtagctggtggattagatggagatattgactta
actggtattactgataatggttataagaacggtaatccagagaaacctaagacacatact
ccagcagtagatgcaggtattaaagctgacaatacacctaagcgtgatattacagtagga
tacactgttaaagtaaattattctgctagtcgttgggctacaggtcaatatatgcctagt
ttcatcaagggtaattcttataaggttatccaagtatctggtaataaagtgttgttagac
ggtgttatgtcttggattaataagtctgatgttgaaattcttcaaacaacagttcaagtt
caatctaacaactctagttactatactgttaaatatggtgacaccttaagtggaattgcc
tataaatatggagtaaatgtatatactctagcccgtaataatggtatcagtaacattaac
tggatctatccaggacaacgattaaagattacagggaatgtatctaatcaacgaacatac
acagtacgttacggcgatactttatctggtattgcttatcgttatggtgtaaacgtgtat
acactagcccgtaacaatggtattagtaatattaattggatttatccaggacaaaggttg
aatatctag

DBGET integrated database retrieval system