KEGG   Lactobacillus salivarius UCC118: LSL_0345Help
Entry
LSL_0345          CDS       T00337                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lsl  Lactobacillus salivarius UCC118
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lsl00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lsl00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
375503..376774
Genome map
AA seq 423 aa AA seqDB search
MKKMIVKGKQTLSGEVTVGGAKNSTVALIPAAILADTVVRFDSVPDILDVHNLMIILKSM
NVSSHFGHGELMIDPTEIKKAPLPGKAIRSLRASYYFMGALLGRFGEAIVDFPGGDNIGP
RPIDQHIKGFEALGAKVVEEKDKVYIKTGPEGLKGARIFFDLVSVGATVNVLLAAVKAKG
TTIIENAAKEPEIVDLATFLNNMGARIRGAGTDVIRIEGVDELRATNTHTIIPDRIEAGT
YLAFAAANGNGVLVKNVITEHLDPFIAKLQEMGVRLEIHEDSIYVPGGDLLVPVTVKTAP
FPGFATDLQQPLTPLLLKAQGSSRIIDTLYPERVKHIPEMRKMGAKISSKDGIITVKRSK
DLLGTTVEASEIRAGVSLLGLALMAEGTTVITKADNILRGYDRIVDKLKGLSVKVEIITD
NRE
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgattgttaaaggtaagcagaccttatctggagaagtaactgttggaggt
gctaaaaatagtacagtggcactgattccagcagctattttggcggacacagttgtaaga
tttgatagtgtaccggatattttagatgtacataatttgatgattattttaaagtctatg
aatgtttcttcccattttggacatggggaattgatgatagatcctactgaaatcaagaaa
gctccacttcctggtaaagctattagaagtttgcgagcttcttattatttcatgggagct
ttgttaggtagatttggtgaagcaattgttgattttcctggtggcgataatattggtcca
cgtcctattgatcaacatattaaaggcttcgaagctttaggtgcaaaagttgtagaagaa
aaagataaagtatatatcaagactggtcctgaaggtttgaagggtgcaagaatcttcttt
gacttagtttcagtaggggctacagttaacgtcttattagcagcagttaaagctaaagga
actacaattattgaaaatgcagctaaagaacctgaaattgtcgacttagctacattttta
aataatatgggagctcgaattcgtggagctggtacagatgttattagaattgagggtgta
gatgaattaagagctacaaatactcatacaattattcctgatagaattgaagcaggtaca
tacttagcatttgcagcagcaaacggtaacggtgtattagtaaaaaatgttattacagaa
catttagatccattcatcgccaagttacaagaaatgggtgtacgtttagaaattcatgaa
gatagcatctatgttcctggtggcgatttattagtccctgtcacagttaaaacagctcct
ttcccaggttttgcgacagatttgcaacaaccactaactccactattattaaaagcacaa
ggtagttctagaattattgatacattatatcctgaacgagttaaacatattcctgaaatg
cgtaaaatgggtgcaaagatttctagtaaagatggaattattactgttaagagatctaaa
gacttactaggaacaacagttgaagctagcgaaattagagctggagtatcattactaggt
ttagcattaatggcagaaggaacaactgtgatcacaaaggctgataatattttacgtggt
tatgacagaatagtagataaattaaaaggtctgtctgtaaaagtagaaattattacagat
aaccgagaatag

DBGET integrated database retrieval system