KEGG   Lactobacillus salivarius UCC118: LSL_0552Help
Entry
LSL_0552          CDS       T00337                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lsl  Lactobacillus salivarius UCC118
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lsl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LSL_0552
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSL_0552
   00052 Galactose metabolism
    LSL_0552
   00500 Starch and sucrose metabolism
    LSL_0552
   00520 Amino sugar and nucleotide sugar metabolism
    LSL_0552
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LSL_0552
   00524 Butirosin and neomycin biosynthesis
    LSL_0552
Enzymes [BR:lsl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LSL_0552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
592926..593888
Genome map
AA seq 320 aa AA seqDB search
MNKKLIGVDLGGTTIKFAILTLDGEIQQKWSVETNILDDGKHIVPDIVESINHHLDLYDM
KPEQFVGIGMGTPGTVDIENGTVEAAFNLNWKEKQNLKEEIEKGTGMKFAVDNDANVAAL
GERWKGAGENDDEVTFVTLGTGVGGGVITNGEMVHGAGAGGEIGHINVQPNGYLCTCGNH
GCLETYASATGVVRVARDMAEEFAGKSDLKKMLDDGQDISSKIVFDLAKDGDVLAERVVD
RVCYYLGFACANIGSLINPSYIVIGGGVSAAGKFLLDQVDSYFKEFAFPSVKKSTTLKLA
ELGNEAGVIGAASLALKFNK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaagttaattggtgttgatttaggcggtacaacaattaaatttgctatcttg
acactagatggtgaaattcaacaaaaatggagtgttgaaactaatattttagacgatggt
aaacatattgttcctgatattgttgaatcaattaatcatcatttagatttatatgatatg
aagccagaacaatttgttggaattggaatgggtacaccgggaacagtagatattgaaaat
ggtacagttgaagcagcatttaacttgaactggaaagaaaagcaaaatctaaaagaagaa
attgaaaagggcactggtatgaagtttgctgtagataatgatgccaatgtagcagcattg
ggtgaacgctggaaaggtgccggagaaaatgatgatgaagtaacatttgttacattaggt
acaggtgttggtggtggtgtcatcactaatggtgaaatggttcacggagctggagctggt
ggtgaaattggtcatataaatgtacaaccaaatggctatttgtgtacttgtggaaatcat
ggctgtttagaaacttatgcttctgcaacaggtgttgtacgtgttgcacgtgatatggct
gaagaatttgctggaaaatctgatttaaagaaaatgttagatgatgggcaagatattagt
tctaagatagtatttgatttagcaaaagatggcgatgttttagctgaacgtgttgtggat
cgtgtttgctactatttaggatttgcttgtgctaatattggtagtcttatcaatccatca
tatattgtaatcggtggtggcgtttctgcagcaggtaagttcttattagatcaagttgat
agttactttaaggaatttgctttcccttcagttaaaaaatcaactactttaaaacttgct
gaattaggaaatgaagctggagttataggtgcagcttcactagctttaaaatttaataag
tag

DBGET integrated database retrieval system