KEGG   Lactobacillus salivarius UCC118: LSL_0611Help
Entry
LSL_0611          CDS       T00337                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lsl  Lactobacillus salivarius UCC118
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:lsl00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
651605..652222
Genome map
AA seq 205 aa AA seqDB search
MAKRGMLIVLSGPSGVGKGTVRKEIFSQPGNKFHYSVSMTTREMRPGEVNGKDYYFVSKE
EFEQEIAAGQMLEYAQYVDNYYGTPLKYVNEMLDSGKDVFLEIEVKGAMQVREKAPDGLF
IFLTPPDLMELRQRIINRGTDDIDTINKRMKKAVDEIEMMQNYDYAVVNDEVEKAAEKIK
TIIRAERWRVKRFLPDYRKQLGELN
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaagaggtatgttgattgttctttctggcccttcaggtgttggaaaaggaact
gtcagaaaagagatattttcacaaccaggtaataaatttcattattctgtttctatgaca
acaagagaaatgcgtcctggagaagtaaacggtaaagattactattttgtatcaaaggaa
gaatttgaacaagaaattgctgctggacaaatgctagagtatgcacaatacgtagataat
tattatggtactccattgaagtatgttaatgagatgcttgatagtggtaaggatgtattt
ttagagattgaagttaaaggtgctatgcaagttagagaaaaggctccggatggcttattt
attttccttacaccaccagatttgatggagttgagacagcgcattattaatcgaggtact
gatgatattgatactattaataaacgtatgaaaaaagcagtagatgagatagaaatgatg
caaaattatgattatgctgttgtaaatgacgaagttgagaaggcagccgaaaaaattaaa
acaataattagagcagaacgctggagagtaaagcgtttcttgccagactatcgaaaacag
ttaggagagttgaattaa

DBGET integrated database retrieval system