KEGG   Lactobacillus salivarius UCC118: LSL_0866Help
Entry
LSL_0866          CDS       T00337                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lsl  Lactobacillus salivarius UCC118
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lsl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LSL_0866 (pfkA)
   01230 Biosynthesis of amino acids
    LSL_0866 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSL_0866 (pfkA)
   00030 Pentose phosphate pathway
    LSL_0866 (pfkA)
   00051 Fructose and mannose metabolism
    LSL_0866 (pfkA)
   00052 Galactose metabolism
    LSL_0866 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    LSL_0866 (pfkA)
Enzymes [BR:lsl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LSL_0866 (pfkA)
Protein phosphatases and associated proteins [BR:lsl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LSL_0866 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
888727..889689
Genome map
AA seq 320 aa AA seqDB search
MKRIGILTSGGDAAGMNAAVRAIARSAMNAGLEAYGINYGYKGLVEGNIFKMESTKLDEI
INRGGTILYSARFPEFAETETQLKGIEQLKKFGIEALVVIGGDGSYHGAEKLTMHGYNSI
GVPGTIDNDIPGTDFTIGFDTAANVAMEALDRINDTATSHQRVFVVEVMGRGAGDIALWS
GIATGADAIVIPEREYDIEAIANKISENRKNGKDHGLIVLAEGVMGAAEFKEKLDQYGDF
DSRAITLGHIQRGGNPTVKDRVLATRLGDYAIRLLLEGKGGLAIGIHDNQLVATDIIDTL
ENHKHQTDVSLQDLNDRVRF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattggtattttaactagtggtggcgatgcagctggtatgaacgcagctgta
cgtgcgattgctcgttctgcaatgaatgcaggtcttgaagcttacggtatcaactacgga
tataaaggacttgtagaaggtaacatctttaagatggaatctacaaaacttgatgaaatt
atcaatcgtggtggtactatcttatattctgcacgtttcccagaatttgcagaaacagaa
acacaattgaaaggtatcgaacaattaaagaaatttggtattgaagcattggttgttatc
ggtggcgatggctcataccatggtgcagaaaaattaactatgcacggatacaattcaatt
ggtgtaccaggaactattgataatgatattccaggtacagactttacaattggtttcgat
actgctgctaatgttgcaatggaagcattagatcgtatcaacgatactgcaacttcacac
caacgtgtattcgttgttgaagttatgggtcgtggcgcaggtgatattgcattatggtct
ggtattgctactggtgcagatgcaattgttattcctgagcgtgaatacgatattgaagct
atcgcaaataaaatttccgaaaaccgtaagaacggtaaagatcatggcttaattgtttta
gcagaaggcgtaatgggcgctgctgaattcaaagaaaagcttgatcaatacggtgatttt
gatagtcgtgctattactttgggacatatccaacgtggtggtaacccaactgttaaagat
cgtgttttagctacaagacttggtgattatgctattcgcttgttacttgaaggtaaaggt
ggtttagctattggtattcatgataatcaattggttgcaactgatatcattgatacactt
gaaaatcacaaacatcaaacagatgtatcattacaagatttgaatgatcgtgttcgtttc
taa

DBGET integrated database retrieval system