KEGG   Lactobacillus salivarius UCC118: LSL_1164Help
Entry
LSL_1164          CDS       T00337                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lsl  Lactobacillus salivarius UCC118
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lsl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LSL_1164 (tpiA)
   01230 Biosynthesis of amino acids
    LSL_1164 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSL_1164 (tpiA)
   00051 Fructose and mannose metabolism
    LSL_1164 (tpiA)
   00562 Inositol phosphate metabolism
    LSL_1164 (tpiA)
Enzymes [BR:lsl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LSL_1164 (tpiA)
Exosome [BR:lsl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LSL_1164 (tpiA)
  Exosomal proteins of bladder cancer cells
   LSL_1164 (tpiA)
  Exosomal proteins of melanoma cells
   LSL_1164 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1198426..1199181)
Genome map
AA seq 251 aa AA seqDB search
MRTPIIAGNWKMNMNPEQTAEFVKAVKDNLPAASEVEAVIAAPAVDLPALLENAKGSDLK
VAAENCYFEDEGAFTGETSPKVLKEMGVDYVVIGHSERRDYFHETDEDINKKAHAIFRNG
LTPIICCGESLETREAGKAEEWVANQVTAALKDLSAEQVASLVIAYEPIWAIGTGKTATA
DQAEEICAVVRKTVADLYDETVADKVRVQYGGSVKPANVKELMAKENIDGGLVGGASLVP
DSYLQLVNYKN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtacaccaattatcgcaggtaactggaaaatgaatatgaatccagaacaaactgca
gaatttgtaaaagctgttaaggataatttaccagcagcatctgaagttgaagctgttatt
gcagctcctgctgttgacttaccggcattacttgaaaatgcaaaaggttctgatttaaaa
gttgcagctgaaaactgctactttgaagatgaaggtgcttttacaggtgaaacatcacca
aaagtactaaaggaaatgggagtagactacgttgttatcggtcattccgaacgtcgtgat
tacttccacgaaactgatgaagatattaacaagaaagctcacgctatcttccgtaatggt
ttaacaccaatcatttgctgtggtgaatctttggaaactcgtgaagctggaaaagctgaa
gaatgggtagcaaatcaagttacagcagctttgaaggatctttccgcagaacaagttgca
agcttagttatcgcttatgaaccaatctgggctatcggtacaggtaagacagctactgca
gatcaagcagaagaaatttgtgcagtagttcgtaagacagttgctgatttatatgatgaa
acagtagctgacaaagtacgtgtacaatacggtggttctgtaaaaccagctaacgttaaa
gaattaatggcaaaagaaaacattgatggtggattagttggtggagcttcattagttcct
gattcatacttacaattagtaaactacaaaaactag

DBGET integrated database retrieval system