KEGG   Lactobacillus salivarius UCC118: LSL_1164Help
Entry
LSL_1164          CDS       T00337                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lsl  Lactobacillus salivarius UCC118
Pathway
lsl00010  Glycolysis / Gluconeogenesis
lsl00051  Fructose and mannose metabolism
lsl00562  Inositol phosphate metabolism
lsl01100  Metabolic pathways
lsl01110  Biosynthesis of secondary metabolites
lsl01120  Microbial metabolism in diverse environments
lsl01130  Biosynthesis of antibiotics
lsl01200  Carbon metabolism
lsl01230  Biosynthesis of amino acids
Module
lsl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lsl_M00002  Glycolysis, core module involving three-carbon compounds
lsl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lsl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSL_1164 (tpiA)
   00051 Fructose and mannose metabolism
    LSL_1164 (tpiA)
   00562 Inositol phosphate metabolism
    LSL_1164 (tpiA)
Enzymes [BR:lsl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LSL_1164 (tpiA)
Exosome [BR:lsl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LSL_1164 (tpiA)
  Exosomal proteins of bladder cancer cells
   LSL_1164 (tpiA)
  Exosomal proteins of melanoma cells
   LSL_1164 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Creatinase_N
Motif
Other DBs
NCBI-GeneID: 3977999
NCBI-ProteinID: YP_536055
UniProt: Q1WSX9
Position
complement(1198426..1199181)
Genome map
AA seq 251 aa AA seqDB search
MRTPIIAGNWKMNMNPEQTAEFVKAVKDNLPAASEVEAVIAAPAVDLPALLENAKGSDLK
VAAENCYFEDEGAFTGETSPKVLKEMGVDYVVIGHSERRDYFHETDEDINKKAHAIFRNG
LTPIICCGESLETREAGKAEEWVANQVTAALKDLSAEQVASLVIAYEPIWAIGTGKTATA
DQAEEICAVVRKTVADLYDETVADKVRVQYGGSVKPANVKELMAKENIDGGLVGGASLVP
DSYLQLVNYKN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtacaccaattatcgcaggtaactggaaaatgaatatgaatccagaacaaactgca
gaatttgtaaaagctgttaaggataatttaccagcagcatctgaagttgaagctgttatt
gcagctcctgctgttgacttaccggcattacttgaaaatgcaaaaggttctgatttaaaa
gttgcagctgaaaactgctactttgaagatgaaggtgcttttacaggtgaaacatcacca
aaagtactaaaggaaatgggagtagactacgttgttatcggtcattccgaacgtcgtgat
tacttccacgaaactgatgaagatattaacaagaaagctcacgctatcttccgtaatggt
ttaacaccaatcatttgctgtggtgaatctttggaaactcgtgaagctggaaaagctgaa
gaatgggtagcaaatcaagttacagcagctttgaaggatctttccgcagaacaagttgca
agcttagttatcgcttatgaaccaatctgggctatcggtacaggtaagacagctactgca
gatcaagcagaagaaatttgtgcagtagttcgtaagacagttgctgatttatatgatgaa
acagtagctgacaaagtacgtgtacaatacggtggttctgtaaaaccagctaacgttaaa
gaattaatggcaaaagaaaacattgatggtggattagttggtggagcttcattagttcct
gattcatacttacaattagtaaactacaaaaactag

DBGET integrated database retrieval system