KEGG   Lactobacillus salivarius UCC118: LSL_1255Help
Entry
LSL_1255          CDS       T00337                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lsl  Lactobacillus salivarius UCC118
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lsl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSL_1255 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    LSL_1255 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LSL_1255 (gpmA)
Enzymes [BR:lsl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LSL_1255 (gpmA)
Membrane trafficking [BR:lsl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LSL_1255 (gpmA)
Exosome [BR:lsl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LSL_1255 (gpmA)
  Exosomal proteins of melanoma cells
   LSL_1255 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1284995..1285669)
Genome map
AA seq 224 aa AA seqDB search
MVKLVLLRHGESTANEANIYTGWSDVPLTIKGCEQAKVAGKKLKEENITFTKAHTSLLER
AIKTGMIVLDEINQSWIPLEKTWRLNERHYGALRGLNKEFTKRKYGKHQVALWRRSFDTV
PPMLDERIEEPKYKKYPSTIIPRAESLKDAYNRILPYWVDEIAPELLHGNNQIVIAHGST
LRAMIKYIENISDEGIDGVEVANAEPIIYELDNKLRVISKKILK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
ttggttaagcttgtattgcttagacatggggaaagtacggctaatgaggcaaatatttat
actggttggtcagatgttccattgacaattaaaggttgtgaacaagctaaagttgcagga
aaaaaattaaaagaagaaaatattacttttactaaagctcatacttctttgttagagaga
gctataaaaacgggaatgattgtattagacgaaatcaatcagtcatggataccacttgaa
aagacttggagattaaacgaacgtcattatggagcattgagaggattaaataaagaattt
acaaagcgtaaatacggaaaacaccaagttgctttatggagacgatcgtttgataccgtt
cctcctatgttggatgaaagaatagaagaacctaaatacaagaaatatccttctacaatt
attccgcgtgcagaaagtttaaaggatgcttataatcgaatactaccatattgggttgat
gaaatagcacctgaattattacatggaaataatcaaattgtgattgctcatggaagtacg
ttaagggcaatgattaagtatattgaaaatattagcgatgaaggaattgatggtgtagaa
gttgctaatgctgaaccaattatttatgaattagataataaacttcgagtaatctcaaag
aaaatactaaaataa

DBGET integrated database retrieval system