KEGG   Lactobacillus salivarius UCC118: LSL_1294Help
Entry
LSL_1294          CDS       T00337                                 

Gene name
glgB
Definition
(RefSeq) glycogen branching protein
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
lsl  Lactobacillus salivarius UCC118
Pathway
lsl00500  Starch and sucrose metabolism
lsl01100  Metabolic pathways
lsl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lsl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LSL_1294 (glgB)
Enzymes [BR:lsl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     LSL_1294 (glgB)
Exosome [BR:lsl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LSL_1294 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM DUF5115
Motif
Other DBs
NCBI-GeneID: 3976546
NCBI-ProteinID: YP_536184
UniProt: Q1WSM8
Position
complement(1337847..1339796)
Genome map
AA seq 649 aa AA seqDB search
MAVNTEERHGQESLENHKHMFNQGVNYELYNFLGVHKISRDDESGYVFRVWAPHAKQVWV
CGDFNNWDKSHPMILDEKSGIWSIEVKESRENQYYKYLVKQANGREIMKTDPMAQVYEKR
PETAAVVKELEPFKWNDGLWRGRQKRMNHFNNPINIYEVHAPSWKEHEDGSLYTFKDLTA
ELIPYVKKMGYTHIEFMPLMEHPLPASWGYQLTGYFALCSSYGTPDEFKDFVNECHQNNI
GVLVDWVPGHFSINDDALAYYDGTPTYEYEDPDRAKNIGWGALNFDLGKPEVQSFLLSSA
FYWLNEFHLDGMRVDAVSNMIYLDYDEGPWKPNKYGDTRNLEGYAFLQKFNKVVKFAHPE
SLIIAEESSSGTQISGTIESGAIGFDYKWNMGWMNDVLEFFEMDPYFRKDNLNLVTFSFM
YWQAENFVLPLSHDEVVHGKKSLMHKMWGDRYRQFAQLRTLYTFMMMHPGKKLLFMSGEW
GQFLEWKFDHGLEWVDLQDEMNAKMQHFTSVLNHFYKEERPLWELGQQDATLEVIDADNH
NDTVLSFIRHGKRKKDFLIVILNFTPVERRNFRIGVPYEGTYTEILNTEMKEFGGTWVEH
NADSVSEEVNFKDYEHSITTTVPALGAIILKPKDIKVTRRSSKKHSHKK
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaatacagaagaacgccacggacaagaatcgctagaaaatcataaacacatg
tttaatcaaggtgtgaactatgaactctataattttttaggtgttcataaaattagtaga
gatgatgaaagcggttatgtttttcgcgtttgggctcctcatgctaaacaagtatgggta
tgtggagactttaacaattgggataaatcccatccgatgattttagatgagaaatctggt
atttggagtatcgaggtaaaagaatctagagaaaatcaatattataaatatctagtcaaa
caagcaaacggtagagaaattatgaagacagatcctatggcacaggtatatgagaaaaga
cctgagacagcagctgtcgtcaaagaattggaaccgtttaaatggaatgacggtctatgg
cgtggcagacaaaaacgtatgaatcattttaataatcctatcaatatttatgaagtacat
gcaccatcatggaaagaacatgaagatggtagtttgtatacgtttaaggatttaacagca
gagttaataccatatgtgaagaagatgggttacactcatatcgaatttatgccattgatg
gagcatccccttccagcatcctggggttatcagttaacggggtactttgctttgtgttca
agttacggtacaccagatgagtttaaggattttgttaatgaatgccatcaaaataatatt
ggtgttttggttgactgggttcctggtcacttcagtattaatgatgatgctttagcatat
tatgatggaactccaacttacgagtatgaagatccagacagagctaagaatataggttgg
ggagctttgaattttgatttaggtaaaccagaagtgcaatcattccttttatcaagtgcc
ttttattggcttaacgaatttcatttagacggtatgcgagtagatgccgtatcaaacatg
atttacctagattatgatgaaggcccatggaaacctaataaatacggagatactcgtaat
ttagaaggatatgctttcctacaaaaattcaataaagttgtgaagttcgctcatcctgaa
tctttgattattgctgaagaaagttcatcaggtacacaaatatcaggaactattgaatct
ggagcaataggatttgattataaatggaatatgggttggatgaatgatgtattagaattt
ttcgaaatggatccatattttagaaaagataacttgaatttagttacattttcatttatg
tactggcaagcagaaaactttgtattacctttatcacatgatgaagtggtacatggtaag
aagagtttaatgcataagatgtggggagacagatatcgtcaatttgcacaattgagaaca
ctttatacatttatgatgatgcatccaggtaagaaattactcttcatgagtggcgaatgg
ggacaattcttagaatggaaatttgatcacggattagagtgggtagatttacaagatgaa
atgaatgctaagatgcaacatttcacttcagttttaaaccacttctacaaggaagaaaga
ccattgtgggaattgggtcaacaagatgctacgttagaagttatagatgctgataatcat
aatgatacagttttaagctttattcgtcatggtaaacgtaaaaaagatttcttgattgtt
atcttaaactttacaccagttgaaagaagaaacttcagaattggtgtcccatatgagggt
acatatactgaaattttaaatactgagatgaaggaatttggtggaacatgggtagagcat
aatgctgatagtgttagcgaagaagttaactttaaagattatgaacattctattactaca
acagttccagctttaggcgcaattatattgaaacctaaagatattaaggtaactcgtcga
agttctaagaaacactcacataagaaataa

DBGET integrated database retrieval system