KEGG   Lactobacillus salivarius UCC118: LSL_1467Help
Entry
LSL_1467          CDS       T00337                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lsl  Lactobacillus salivarius UCC118
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lsl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LSL_1467
  Amino acid metabolism
   00300 Lysine biosynthesis
    LSL_1467
Enzymes [BR:lsl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     LSL_1467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1527832..1528968)
Genome map
AA seq 378 aa AA seqDB search
MNEMDKIKVLADIVEIPSVNDDEVSVAKYIRDLFAKYGIESKILKVKGNRANLVAEIGEK
GPILGFSGHLDVVAAKESDGWHSDPFKLVERDGKLYGRGTSDMKSGVAAMIVSLIELQQK
GLKNGRIRLMLTMGEEIGEEGSAYFYEHGYMKDVSALVISEPTYYRIIYAEKGSLDLKIT
SRGKAAHSSMPNLGYNAVNPLIELLSELNEFFSNPPKNDVLGPLTFNVTVFKGGEQVNTI
PDYAEAEINVRTLPNFDGNDVIKKLDEYLEKKNENGATLTREVLMNEDAVLKSPDSVIAD
LAAEIVESRGREVVKTIAPGITDASNLLKEKKEDYPFIVFGPGNPLVSHQVDEYVEKKAY
LDFIDIYQELAEKYFIND
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaatggataaaatcaaagtattagcagatattgttgaaatcccatcagtaaac
gatgatgaagtgagtgtagctaaatatataagggatttatttgcaaaatatggaatcgaa
tctaaaattttaaaagttaaagggaacagggccaatttagttgcagaaataggagaaaaa
ggtcccattctaggattctcagggcatttagatgtagttgcagctaaggaaagtgatggt
tggcatagtgatccatttaaattagttgaaagagatgggaaactttatggtcgcggaaca
tcagatatgaagtctggggtagcagcgatgatcgtttctttaattgaattgcagcaaaaa
ggattaaaaaacggaagaattcgcttgatgctgacaatgggtgaagaaataggggaagaa
ggatcagcatatttttacgaacatggctatatgaaagatgtttctgccttagtgattagt
gaacctacgtattacagaataatttatgcggaaaaaggttcattagatttgaagattact
tctagaggtaaagctgcacatagttcaatgccaaatcttgggtataatgctgtaaatcca
ctaattgaattacttagtgaattaaatgaatttttcagtaatccaccaaaaaatgatgta
ttagggccacttacattcaatgtgacagtctttaaaggtggagaacaagtaaatacaatt
cctgattacgctgaagcggaaattaatgttcggacattacctaattttgacggaaatgat
gtaattaagaagttagatgaatatcttgaaaagaaaaatgaaaatggcgctacattaacg
agagaagttttaatgaatgaagatgcagtactaaaatcaccagattcagtaattgctgat
ttagctgctgaaattgttgaaagccgtggaagagaagtcgttaagaccattgcaccaggt
attacggatgcttctaatttactaaaggaaaagaaagaagattatccatttatagtattt
ggtccaggtaatccattggtaagtcatcaagtagatgaatatgtggaaaagaaagcttat
ctagattttattgatatttatcaagagttagctgaaaaatattttattaatgattag

DBGET integrated database retrieval system