KEGG   Lactobacillus salivarius UCC118: LSL_1509Help
Entry
LSL_1509          CDS       T00337                                 

Definition
phosphoketolase (EC:4.1.2.22 4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
K01632  
fructose-6-phosphate phosphoketolase [EC:4.1.2.22]
Organism
lsl  Lactobacillus salivarius UCC118
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lsl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LSL_1509
Enzymes [BR:lsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     LSL_1509
    4.1.2.22  fructose-6-phosphate phosphoketolase
     LSL_1509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1564195..1566555
Genome map
AA seq 786 aa AA seqDB search
MTDYSSQEYLDKLDAYWRAANYVSVGQLYLKDNPLLRRPLKAKDVKVKPIGHWGTIAGQN
FIYDHLNRVINKYDLNMFYVEGPGHGGQVMVSNSYLDGSYSEIYPEISQDEQGMKRLFKR
FSFPGGVASHAAPETPGSIHEGGELGYSISHSVGAVLDNPDLIVAAVVGDGEAETGPLAA
SWQSNKFINPIHDGAVLPILDLNGFKISNPTILSRESDETLTKYFEGMGWHPIFVEGDDP
KLMHPAMAKAMDEAIEEIKAIQKNARENNDPSLPAWPVIIFRAPKGWTGPKEWDGEPIEK
SFRAHQIPIPVDQNDMQHADALVDWLESYKPEELFDENGKLKAEIAEITPKGDKRMAANP
HTNPGKLIREVIKPDFRDFAVDTSVPGKEVAQDMTVLGKYLEKVLSDNRHNYRVFGPDET
MSNRLAPIFDVTKRQWLAEIKEPNDQYLAPSGQVIDSQLSEHQAEGFLEGYVLTGRHGFF
ASYESFLRVVDSMLTQHFKWLRKATEQPWRTSIPSLNVIATSTVFQQDHNGYTHQDPGIL
GHLADKKPEYIREYLPADANSLLAVFDKTINDRDKINLIVASKHPRQQFYSAAEAKELVD
KGLKIIDWASTDKNAEPDVVIAAAGTEPNLEALAAISILHEKLPDLKIRFINVVDILKLR
SPKVDPRGLSDDEFDAYFTKDKPVIFAFHGYEGLLRDIFYYRHNHNVAFHGYRENGDITT
PFDMRVLSQMDRFDLVKSVALSLPDADKYGQLVAEMDAKVAKHHQYIRDEGTDLPEVKNW
EWKPLD
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgacagattattcatcccaagaatacttagataaattagatgcttattggcgtgctgct
aactatgtttcagttggtcaattatacttaaaagataatcctttacttcgccgtccttta
aaggcaaaagacgttaaggttaaaccaattggtcactggggaactatcgctggccaaaac
ttcatttatgaccatttgaaccgtgtcatcaacaaatatgacttgaatatgttctacgtt
gaaggcccaggtcatggtggtcaagttatggtttctaactcgtatcttgatggttcttac
tctgaaatttatcctgaaatttctcaagatgaacaaggtatgaagcgtctatttaaacgt
ttctccttcccaggtggtgtagcttctcatgctgctcctgaaacaccaggttctattcat
gaaggtggcgaattaggttactctatttctcactctgttggtgcagttttagataatcct
gatttgattgttgctgcagttgtcggtgatggtgaagctgaaactggtccattagctgct
tcatggcaatctaataaatttatcaaccctattcatgatggtgctgtcctaccaatttta
gatcttaacggattcaagatttctaaccctactatcctttctcgtgaaagcgatgaaact
ttgactaagtactttgaaggtatgggttggcatccaatctttgttgaaggcgatgatcct
aagttgatgcatcctgcaatggctaaagcaatggatgaagcaattgaagaaatcaaggct
attcaaaagaatgctcgtgaaaataacgatcctagtcttccagcatggcctgttattatc
ttccgtgctcctaaaggttggactggtcctaaagaatgggatggcgaaccaattgaaaaa
tcattccgtgcccatcaaattccaattcctgttgaccaaaatgatatgcaacatgctgat
gctttggttgattggcttgaaagttataaacctgaagaattattcgatgaaaatggtaag
ttgaaagctgaaattgctgaaatcacacctaagggcgacaagcgtatggctgctaaccct
cacactaaccctggtaaattaattagagaagttatcaagcctgatttccgtgattttgcc
gttgatacatctgttccaggtaaagaagttgctcaagatatgactgttttaggtaaatac
cttgaaaaagtactttctgataaccgtcataactatcgtgtctttggtcctgacgaaaca
atgtctaaccgtttggcacctatctttgacgtaactaagcgtcaatggttagctgaaatt
aaggaacctaacgatcaatacttagctccatcaggtcaagttattgattctcaattatca
gaacaccaagctgaaggtttcttagaaggatatgttttgactggtcgtcatggtttcttt
gcaagttatgaatcattcttgcgtgtagttgactctatgttgacacaacacttcaagtgg
ttacgtaaagcaactgaacaaccttggcgtacatcaattccatcattgaatgttattgct
acatctactgtattccaacaagatcacaatggttacacacaccaagatcctggtatttta
ggtcacttagctgataagaaacctgaatatattcgtgaatacttacctgcagatgctaac
tcattattggctgtcttcgataagactattaatgatcgcgataagattaacttgattgtt
gcttctaagcacccacgtcaacaattctactcagctgcagaagctaaggaattagttgat
aaaggcttgaagattattgattgggcttcaactgataagaatgctgaaccagacgtagtt
atcgctgctgctggtacagaaccaaacttagaagctttagctgcaatttctatcttgcat
gaaaaattacctgacttgaagattcgcttcatcaatgttgttgatatcttgaagttacgt
agtcctaaggtagatcctcgtggcttaagcgatgatgaatttgatgcttactttacaaaa
gacaagccagttatctttgctttccatggttatgaaggcctattacgtgacatcttctac
taccgtcacaatcataacgttgctttccacggctatcgtgaaaatggtgatatcacaact
ccattcgatatgcgtgtgttaagccaaatggatcgcttcgatcttgtaaaatctgttgca
ctttctcttccagatgctgacaaatatggtcaacttgttgctgaaatggatgctaaagtt
gctaagcatcatcaatacattcgtgatgaaggtactgatttaccagaagttaaaaactgg
gaatggaagcctcttgattaa

DBGET integrated database retrieval system