KEGG   Lactobacillus salivarius UCC118: LSL_1511Help
Entry
LSL_1511          CDS       T00337                                 

Gene name
gpmB
Definition
(RefSeq) phosphoglycerate mutase
Organism
lsl  Lactobacillus salivarius UCC118
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1567308..1567898
Genome map
AA seq 196 aa AA seqDB search
MTTFYIIRHGQSEANAKGILQGSQIDTPLTELGRSQAQVTLSKLGTDNFDAIYASPLLRA
AQTATIIGGSDKTITFDPRLKEYDYGTWDGEIEADIWQKYPQYFDEHHNLLPNSWVDSKG
DTYLEVKSRLESFFDEVIARHPDDSVLVVSHGFTIKLILDYILNIGNLVNISEPTNAGIT
KVKMTKDTKTVIYFNR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattttatattatccgtcacggacaaagtgaagctaatgctaagggaattctt
caaggtagccaaattgacactccactaactgaacttggacgctctcaagctcaagttaca
ctttcaaaacttggaactgacaattttgacgctatctatgctagtccgcttttacgagct
gctcaaactgccactattatcggtggtagtgataaaactattacttttgatcctcgccta
aaagaatatgattatggcacttgggacggagaaatcgaagctgatatttggcaaaagtat
ccccaatatttcgatgaacatcacaatttacttcctaattcttgggtggattcaaaaggt
gatacatatttagaagtaaaatcacgtttagaatctttcttcgatgaagttattgctcga
catccagacgactctgtgttagttgttagtcatggtttcaccatcaaattaatcttagat
tatattctcaatatcggtaatctagttaatattagtgaacctacaaatgctggtattact
aaggttaaaatgactaaagatactaaaactgttatttacttcaatcgctaa

DBGET integrated database retrieval system