KEGG   Lactobacillus salivarius UCC118: LSL_1511Help
Entry
LSL_1511          CDS       T00337                                 

Gene name
gpmB
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
lsl  Lactobacillus salivarius UCC118
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lsl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LSL_1511 (gpmB)
   01230 Biosynthesis of amino acids
    LSL_1511 (gpmB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSL_1511 (gpmB)
  Energy metabolism
   00680 Methane metabolism
    LSL_1511 (gpmB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LSL_1511 (gpmB)
Enzymes [BR:lsl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     LSL_1511 (gpmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1567308..1567898
Genome map
AA seq 196 aa AA seqDB search
MTTFYIIRHGQSEANAKGILQGSQIDTPLTELGRSQAQVTLSKLGTDNFDAIYASPLLRA
AQTATIIGGSDKTITFDPRLKEYDYGTWDGEIEADIWQKYPQYFDEHHNLLPNSWVDSKG
DTYLEVKSRLESFFDEVIARHPDDSVLVVSHGFTIKLILDYILNIGNLVNISEPTNAGIT
KVKMTKDTKTVIYFNR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattttatattatccgtcacggacaaagtgaagctaatgctaagggaattctt
caaggtagccaaattgacactccactaactgaacttggacgctctcaagctcaagttaca
ctttcaaaacttggaactgacaattttgacgctatctatgctagtccgcttttacgagct
gctcaaactgccactattatcggtggtagtgataaaactattacttttgatcctcgccta
aaagaatatgattatggcacttgggacggagaaatcgaagctgatatttggcaaaagtat
ccccaatatttcgatgaacatcacaatttacttcctaattcttgggtggattcaaaaggt
gatacatatttagaagtaaaatcacgtttagaatctttcttcgatgaagttattgctcga
catccagacgactctgtgttagttgttagtcatggtttcaccatcaaattaatcttagat
tatattctcaatatcggtaatctagttaatattagtgaacctacaaatgctggtattact
aaggttaaaatgactaaagatactaaaactgttatttacttcaatcgctaa

DBGET integrated database retrieval system