KEGG   Lactobacillus salivarius UCC118: LSL_1521Help
Entry
LSL_1521          CDS       T00337                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lsl  Lactobacillus salivarius UCC118
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lsl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LSL_1521 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LSL_1521 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LSL_1521 (thrC)
Enzymes [BR:lsl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LSL_1521 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1583777..1585264
Genome map
AA seq 495 aa AA seqDB search
MATLYRSTRDASAHSISSSQAVLQGISPDGGLFVPVDFPKLDLDLSQLPSLSYQGLAYKI
LQPFFSDFTEDELRSCINSAYGSNFTSEEITPVSYHAGNIYLELFHGPTIAFKDVALQLL
PYLLITSAKKNNSNLKNVILTATSGDTGKAAMAGFADVENTQIIVFYPKYGVSPIQEKQM
LTQTGKNVYVVGITGNFDNAQTNVKQIFNNSTLTDELLKSGYQFSSANSINIGRLLPQIV
YYFYAYGRLLADNKIKLGDNVNFSVPTGNFGDILAGFFAKKLGLPINKLLCASNENNVLT
EFFKTGTYNKKRDFKVTNSPSMDILVSSNLERLLFYATNGNAALVAEWMNQLEKEGEYTV
DPDTLKFLQTHFYASSASQTDTKNEIKQVFTESNYAIDPHTAVASFVTREYKESTADSCP
TVTVSTASPYKFPQTVLAALGVDNATGDLDDVQKLVDLIKLPLPKTVANLFEAKQLHDTV
IEPDEMENYVKELLI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcaactttgtatcgtagtacacgcgacgcttcagctcatagtatttcttcatctcaa
gctgttcttcaaggaattagtcccgatggtggtttgtttgttccggttgattttcctaaa
ttagatttagatttatcacaattgccatcgctatcctatcaaggactagcttacaaaatt
ctccaaccttttttcagtgactttaccgaagacgaattgcgttcatgcatcaactctgct
tatggcagtaattttactagtgaagagattaccccagtttcctatcatgctggtaatatt
taccttgaactatttcatggtcctacaattgcttttaaagatgttgcgctacaattatta
ccttacctattaataacatcagctaagaaaaataattctaatctgaagaacgtcatctta
actgctacttcgggcgatacaggtaaagctgccatggctggattcgcagatgtagaaaat
acgcaaattattgttttttatcctaaatacggcgttagtcctattcaagaaaaacaaatg
cttacacaaactggtaaaaatgtctatgtggttggtattactggtaatttcgataatgct
caaacaaatgttaagcaaatttttaataattcaactttaactgatgaactactaaaaagt
ggctatcaattttcatcagctaactctattaatattggtagattattaccacaaattgtt
tattacttctatgcttatggacgattattagctgataataaaatcaagttaggcgataat
gttaatttcagtgttccaactggaaactttggtgatattttagctggattcttcgctaaa
aaacttggcttacctattaataagctactatgtgcatcaaacgaaaataatgtcttaact
gaatttttcaagactggtacatataataagaaacgtgatttcaaagttacaaactctcct
tcaatggatatccttgtatctagtaacttagaacgcttattattctacgctacaaatgga
aatgcagctttagtggctgaatggatgaaccaacttgaaaaagaaggcgagtatactgtt
gacccagatacacttaaattcctccaaacacatttctacgctagttcggcaagtcaaact
gatactaaaaatgagattaagcaagttttcactgagagtaattatgctattgaccctcat
accgcagttgcttcctttgttactcgagaatataaagaatcaactgctgattcttgtcca
acagttacagtatctacggcaagtccgtataaattcccacaaacagttctagctgcttta
ggagtagataacgcaactggtgatttagatgacgtacaaaaattagttgatttaattaaa
ctgcctctacctaagacggtcgccaatctatttgaagctaaacaattacatgatactgtt
attgaacctgatgagatggaaaattatgttaaagaattgctgatttaa

DBGET integrated database retrieval system