KEGG   Lactobacillus salivarius UCC118: LSL_1568Help
Entry
LSL_1568          CDS       T00337                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lsl  Lactobacillus salivarius UCC118
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:lsl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LSL_1568
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    LSL_1568
Enzymes [BR:lsl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     LSL_1568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1652242..1653345)
Genome map
AA seq 367 aa AA seqDB search
MRKFLLVVIICLSCIVAFQDKVFAKNISDKKIQKIVNNMTLDEKIGQLYMSPSSGDAAKM
TNDIKKYNLGGIVLFGEDFSNQNADTMKQKDANFQNASKYGLFISTDQEGGIVSRLSTSP
QLTNGRKFPSPQEVYKQSGMSGVVKEYSSVAEILRNLGINWDFAPVADVSNDPNSFIYDR
TLGQNYQLTAQYVSKVVPAIQKQQVAATVKHFPGYGSAGDTHTGFASDGRSINEFRQNDF
LPFKAGIKAKADSVLVGHVVVNNLDATKPASVSKPVHEILRKELKFKGVIITDDMGMGAL
TSFAQKQHTNIDVMAIEAGNDMLLSNGYVDGIPAIKDAIKRGDISQKQIDNSVKRILRLK
AKLNIMK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagtttttactggtagttattatatgcttatcgtgtatagtagcttttcaagac
aaggtattcgctaagaatatttctgataaaaaaattcagaaaatcgtaaataatatgaca
ttagatgagaagatagggcaattatatatgagtcctagttcaggcgatgctgctaaaatg
acaaatgatataaagaaatataatttagggggaattgttttatttggagaagatttcagc
aaccaaaatgcagatacaatgaaacaaaaagatgcaaattttcaaaatgctagtaagtat
gggttgtttatctctactgaccaagaaggtggaattgtttctagattaagtacaagtcca
caattaacaaatggaagaaaatttccttccccacaagaagtatataaacaatctggaatg
tctggagtagtgaaagaatacagtagtgtagctgaaattttacgtaatttgggtattaat
tgggactttgcaccagttgcagatgtttctaatgatccaaacagctttatatatgatagg
acactgggtcagaattatcaattaacagcacaatatgtgtcaaaggtcgtaccagcaatt
caaaagcaacaagtagctgcgacagtaaagcattttccagggtatggttcagctggagat
acacatacaggttttgctagcgatggacgtagtataaatgaatttaggcaaaatgatttt
ctaccatttaaagctggaataaaagctaaagctgattcagtattggtgggacatgttgtt
gttaataatttagatgcaactaaaccagcttctgtatcaaaaccagtacatgaaatttta
agaaaagaattgaaatttaaaggtgttattattactgatgatatgggaatgggagcatta
actagctttgcgcagaagcagcacacaaatatagatgtgatggcgattgaagctggaaat
gatatgttactaagcaatggttatgtagatggaataccagccatcaaagatgcaataaag
cgtggagatatatcccaaaaacaaattgataattcagtaaaaagaatattgagattaaaa
gccaaattaaatattatgaaataa

DBGET integrated database retrieval system