KEGG   Lactobacillus salivarius UCC118: LSL_1568Help
Entry
LSL_1568          CDS       T00337                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lsl  Lactobacillus salivarius UCC118
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lsl00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:lsl00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1652242..1653345)
Genome map
AA seq 367 aa AA seqDB search
MRKFLLVVIICLSCIVAFQDKVFAKNISDKKIQKIVNNMTLDEKIGQLYMSPSSGDAAKM
TNDIKKYNLGGIVLFGEDFSNQNADTMKQKDANFQNASKYGLFISTDQEGGIVSRLSTSP
QLTNGRKFPSPQEVYKQSGMSGVVKEYSSVAEILRNLGINWDFAPVADVSNDPNSFIYDR
TLGQNYQLTAQYVSKVVPAIQKQQVAATVKHFPGYGSAGDTHTGFASDGRSINEFRQNDF
LPFKAGIKAKADSVLVGHVVVNNLDATKPASVSKPVHEILRKELKFKGVIITDDMGMGAL
TSFAQKQHTNIDVMAIEAGNDMLLSNGYVDGIPAIKDAIKRGDISQKQIDNSVKRILRLK
AKLNIMK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagtttttactggtagttattatatgcttatcgtgtatagtagcttttcaagac
aaggtattcgctaagaatatttctgataaaaaaattcagaaaatcgtaaataatatgaca
ttagatgagaagatagggcaattatatatgagtcctagttcaggcgatgctgctaaaatg
acaaatgatataaagaaatataatttagggggaattgttttatttggagaagatttcagc
aaccaaaatgcagatacaatgaaacaaaaagatgcaaattttcaaaatgctagtaagtat
gggttgtttatctctactgaccaagaaggtggaattgtttctagattaagtacaagtcca
caattaacaaatggaagaaaatttccttccccacaagaagtatataaacaatctggaatg
tctggagtagtgaaagaatacagtagtgtagctgaaattttacgtaatttgggtattaat
tgggactttgcaccagttgcagatgtttctaatgatccaaacagctttatatatgatagg
acactgggtcagaattatcaattaacagcacaatatgtgtcaaaggtcgtaccagcaatt
caaaagcaacaagtagctgcgacagtaaagcattttccagggtatggttcagctggagat
acacatacaggttttgctagcgatggacgtagtataaatgaatttaggcaaaatgatttt
ctaccatttaaagctggaataaaagctaaagctgattcagtattggtgggacatgttgtt
gttaataatttagatgcaactaaaccagcttctgtatcaaaaccagtacatgaaatttta
agaaaagaattgaaatttaaaggtgttattattactgatgatatgggaatgggagcatta
actagctttgcgcagaagcagcacacaaatatagatgtgatggcgattgaagctggaaat
gatatgttactaagcaatggttatgtagatggaataccagccatcaaagatgcaataaag
cgtggagatatatcccaaaaacaaattgataattcagtaaaaagaatattgagattaaaa
gccaaattaaatattatgaaataa

DBGET integrated database retrieval system