KEGG   Lactobacillus salivarius UCC118: LSL_1759Help
Entry
LSL_1759          CDS       T00337                                 

Definition
Type III restriction-modification system restriction subunit (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
lsl  Lactobacillus salivarius UCC118
Brite
Enzymes [BR:lsl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     LSL_1759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pMP118:35658..38285
Genome map
AA seq 875 aa AA seqDB search
MVKKKQVVQKELPLLKKIEDFRQASLIEDDPAYYFKIEDYIKDNLKHNLRPYQAEALYAL
NYTQTREEPHNQVLFNMATGSGKTDTMAGAILYLYNTHKYRNFIFVANTNAVVSKTKENF
LNENSPKYLFKSPITIDGRRIEIRSVDRFPSYQEPDIIYLKLTTIQSLANELGSIRENGL
TYEELEKNKMVILADEAHHFNASTKSQKVEEKSWEILLDKIRNINSDNRQLEFTATIDID
KELVYEKYKDKIIYKYDLNRFMEDGYSKNVYRLEANNNDKTKMLNAVLLSQYRKRIAKKF
GIDNFKPVILFKSNKVAISCQAKDDFLEMINDLDANKLGEFLSEQSNITHSTTLRRMYEY
WLDQDLAQTVIEVKRDFKPLTTVNANDTKKEGILGDVNDFNNLNTLEDMNNPIRTVFAVA
KLTEGWDVLNLYDIVRIGEQPVTTTQTNSEAQLIGRGARYNPFIYNGKKSYTRRFDGDSR
ELRLLESLYYHTINDVKYINNLLKSFDKMNLVSEGDNDNDYKVFTALVKESFKKSRVYKY
GKIYHNQLEDVPESDYNNLGSYGFNKDTITIDMNDSTVEHERSQESQLNEADSREVIVAD
FRSTKYIRLLKKAMSKDSFFRFSELSKYIPNLRSLDEFMTSKNWLGNLRVNATIPYNRMA
IDNEFRLEVVVKALSKVKQALRTNYLKKRGTNKFEPVPVKDIVVDYTKRVSNNKTGIQAI
IDRKEMIRDDWFVYDQAIVDQLESNLIDMIRNLVSDLKKEYRDVYLIRNEETINKLKLYE
FGKVDDDVFHYQGFMPDFLLYLNDGEETYQLFIEPKGEQLLVRDNWKEKLLEKIKPENIK
LIGEDEKIKLYGVKFFRYGNGRDIEEELMSYTIDN
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atggttaagaaaaaacaagtagtacaaaaagaactacccttactaaaaaagatcgaagac
tttcgacaagctagtttaattgaagatgatccagcttactactttaaaattgaagattat
attaaagataatttaaaacataatttaagaccgtaccaagctgaagctttatacgcatta
aactacacacaaacacgtgaagaaccacataatcaagtattattcaatatggcgactggt
tcaggaaagacagatactatggctggagcaattctttatttgtataatactcataaatat
agaaattttatatttgtagctaatacaaatgctgttgtatcaaaaactaaggaaaatttt
ctcaatgaaaactcacctaaatatttatttaaatcaccaataacaattgatggtagaaga
atagagatacgatcagttgatagatttccaagttaccaagagccagatattatttatcta
aaattaacaactattcaatcattagctaatgaattgggaagtattagggaaaatggactt
acttatgaagaacttgagaaaaataaaatggtgattttagctgatgaagcccaccatttt
aatgcaagcacaaagtctcaaaaggtagaagaaaaatcttgggaaatattacttgataaa
attagaaatataaattctgataatcgtcaattagaatttactgctactattgacattgat
aaggaacttgtatatgaaaaatataaagacaagattatttataagtatgacttaaataga
tttatggaagatggttattccaagaatgtttatcgcttagaagctaataacaatgataaa
actaagatgttaaatgctgttttgttaagtcaatatcgtaaaagaattgccaaaaaattt
ggaattgataattttaaaccggttattttatttaaatcgaataaagttgcaatatcttgc
caggcaaaagatgattttttagaaatgataaatgatctggatgctaataaacttggtgaa
tttttatctgaacaaagcaatattacccatagtacaacattgagaagaatgtacgaatac
tggttggatcaagatttggctcagacagtaattgaagtaaagcgagatttcaaaccttta
acaacagttaatgcaaatgacacaaaaaaagaaggaattctaggagatgtcaatgatttt
aataatttgaataccttggaagatatgaacaatccaattaggacagtttttgcggttgca
aaattgacagaaggttgggatgttttgaacctttatgatattgtcagaattggagaacag
ccggttacgacgactcagacaaatagtgaagcccagttaataggtagaggtgctagatat
aatccatttatttataatggtaaaaagtcatatactcgaagatttgatggggatagtcgt
gaattaagattattagaatctttatactatcatacgattaatgatgttaagtatattaat
aatttattgaagtcatttgataagatgaatttagtttcagagggagacaatgataatgac
tataaagtatttactgcgttagttaaagaaagtttcaaaaaatctagagtatacaaatat
ggaaagatatatcataatcaattagaagatgttcctgaatctgattacaataatttaggc
agttatggttttaataaagatacgattactattgatatgaatgatagtactgttgaacat
gaaagaagtcaggagagtcaattaaatgaagcagatagtagagaagttatcgttgctgat
ttcagaagtactaaatatattagattattaaaaaaagcgatgtcaaaagatagtttcttt
agattctcagaactttcaaagtatattcctaatttacgatcactagatgaatttatgaca
tctaaaaattggttggggaatttacgagtaaatgctactataccatataatagaatggcg
attgataatgagtttaggctagaggttgtggttaaggcattatcaaaagtaaaacaagct
cttagaacaaattatttgaaaaaacgtggaacgaataagtttgaaccggtaccagttaaa
gatattgttgttgactatactaagcgagtatcaaacaataaaacagggatacaagcaata
attgatcgaaaagaaatgattagagatgattggtttgtatatgatcaagctattgtagac
caattagaaagtaatttgattgatatgattagaaatttagtttctgatttaaagaaagaa
tatagagatgtatacctaattcgtaatgaagaaactatcaataagttgaaattatatgaa
tttggtaaagtagatgacgatgtattccattaccaaggatttatgcctgactttttatta
tacctaaatgatggagaagagacttatcaattatttatcgaaccaaaaggggaacaattg
ttagtaagggataactggaaagaaaagttacttgaaaagattaaaccggagaatattaaa
cttattggtgaagatgaaaagattaagctttacggagtaaaattctttagatacggtaat
ggtagagacattgaagaggaattaatgtcatatacaatagataactaa

DBGET integrated database retrieval system