KEGG   Lactobacillus salivarius UCC118: LSL_1903Help
Entry
LSL_1903          CDS       T00337                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lsl  Lactobacillus salivarius UCC118
Pathway
lsl00010  Glycolysis / Gluconeogenesis
lsl00030  Pentose phosphate pathway
lsl00051  Fructose and mannose metabolism
lsl00680  Methane metabolism
lsl01100  Metabolic pathways
lsl01110  Biosynthesis of secondary metabolites
lsl01120  Microbial metabolism in diverse environments
lsl01130  Biosynthesis of antibiotics
lsl01200  Carbon metabolism
Module
lsl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lsl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSL_1903
   00030 Pentose phosphate pathway
    LSL_1903
   00051 Fructose and mannose metabolism
    LSL_1903
  Energy metabolism
   00680 Methane metabolism
    LSL_1903
Enzymes [BR:lsl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     LSL_1903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos Metallophos_2
Motif
Other DBs
NCBI-GeneID: 3978375
NCBI-ProteinID: YP_536791
UniProt: Q1WQZ0
Position
pMP118:complement(195235..197205)
Genome map
AA seq 656 aa AA seqDB search
MNFDDNEELVNKQVDMNAYSHNLLKEKYPTKQDVITEIMNLEAILHLPKGTEHFVSDLHG
EYTAFDHVLRNGSGSIKQKIQDYFSDRMTEQTMQDFALLIYYPEDELALVKKKLRTENEL
QQWYLDNISHLLEFLELSGSKYTRSKVRKALNPNFVYITEELLYNDPQEFNKRSYINQLL
KNILKLDQADKFIIATCYTIQRLVVDHLHVLGDVYDRGEEPDKIMDRLMNYHSVDMQWGN
HDLLWLGAMAGSKLCMLNLLRICARYNNLNIIEDAYGINLRHLSRFAEEQYEDNPQFRPK
LTNGDGYRFNGEKLQITQIHQAVAMMQFKLEGQVIARRPELKMDDRDLLNKIDYKKNVIN
LNGKEYSLQNTCFNTVDPKNPNELTDEENAIVDELLISIQHSTKLKRHLDFMMNKGSMYR
TYNGNLLFHGCIPADEEGNFCSLKIGSKEYSGKKLFDFSEKMIRKAYSKPNVKDDFATDF
MWYLWQGALSPLFGKKSMTTFERYFIADKACHEEVKNPYYKLRENKDFCIKILQEFGFAG
DDTNHIINGHTPVKRGHNAICAEGYMLVIDGGYSKAYQPTTGIAGYTLLYNSYGLQLVSH
QPFTSKQDAIRSGKDIVSTVRVVKHELQRKSVADTDIGENIKEKIRVLYNLLRNYD
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgatgataatgaagaattagtaaataagcaagttgacatgaatgcttattcg
cataacttattaaaagaaaaatatcctacgaaacaagatgtgattactgaaattatgaac
ttggaagcaattttgcatcttccaaagggaactgaacactttgtaagtgatttgcatggg
gagtatacagcatttgatcacgttttaagaaatggttctgggagtattaaacagaaaatt
caagattacttttcagatagaatgacagaacaaacgatgcaagattttgctttgctaatc
tactatcctgaagatgaattggctttagtaaagaaaaaattacgtacagaaaatgagcta
caacaatggtacttagataacatttcccacttattagaatttttagaattatcaggaagc
aagtatacgcgctcaaaggttcgtaaagcactaaatcctaattttgtatacataacagaa
gaattattatataacgatccacaagaatttaataagagaagttatattaatcaacttttg
aagaatattttgaaattagatcaagcagataaatttattattgctacctgttacacaatt
caaagattagtagtagatcacttacatgttctaggcgatgtttacgataggggagaagaa
ccagacaaaattatggatagattgatgaattatcattctgtcgatatgcaatggggaaat
catgatttactatggctaggtgcaatggcaggctcaaaactatgtatgttgaatttattg
agaatttgtgcaagatataataatttaaatattatagaagatgcatatggcattaatcta
cgtcacctatcaagatttgctgaagaacaatatgaagataatcctcagtttagacctaag
ttgaccaatggtgatggatatagatttaacggtgaaaagttacaaattacacagattcac
caagctgttgcgatgatgcaatttaaacttgaagggcaagttatagctagaaggccagaa
ttaaaaatggatgatcgagatttacttaataaaatagattacaagaaaaatgtaattaat
ttaaatggtaaagaatactcattacaaaatacttgtttcaatacagtagacccaaagaac
cctaatgaattaacagatgaagaaaatgcgattgtagatgaattattaatttctattcaa
cattctacaaaattaaaacgtcatctagatttcatgatgaataaaggtagcatgtatcgt
acatataatggcaatcttctattccacggatgtattccggcagatgaagaaggaaatttt
tgtagcttgaagattggtagtaaagaatattcaggtaaaaagttatttgatttttctgaa
aagatgattcgaaaagcttactctaagccaaatgtaaaagatgattttgccactgatttt
atgtggtatttatggcaaggagctctttccccactgtttggtaagaaatctatgactact
tttgaacgttattttattgcagataaagcttgtcatgaagaagtaaagaatccatattat
aaattaagggaaaataaggatttctgcatcaaaattttacaagaatttggatttgctggc
gatgatactaatcatattattaatggtcatactccagttaaaagaggccataatgcaatc
tgcgcagagggttatatgttggtaattgatggaggatactccaaagcctatcagccaaca
acagggatcgctggatatacattattgtataattcatatggcttgcaactagtttcgcat
caaccatttacttcaaaacaagatgctattagaagtgggaaagatatcgtttcaacggtt
cgagtggtaaagcatgaattacaacgaaaatcagttgcggatactgatattggtgaaaat
attaaagaaaaaattagagttttgtataatttattgagaaattatgattag

DBGET integrated database retrieval system