KEGG   Lactobacillus sanfranciscensis: LSA_01210Help
Entry
LSA_01210         CDS       T01627                                 

Gene name
atoB
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lsn  Lactobacillus sanfranciscensis
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Benzoate degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:lsn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LSA_01210 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    LSA_01210 (atoB)
   00640 Propanoate metabolism
    LSA_01210 (atoB)
   00650 Butanoate metabolism
    LSA_01210 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    LSA_01210 (atoB)
   00072 Synthesis and degradation of ketone bodies
    LSA_01210 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LSA_01210 (atoB)
   00310 Lysine degradation
    LSA_01210 (atoB)
   00380 Tryptophan metabolism
    LSA_01210 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LSA_01210 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LSA_01210 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LSA_01210 (atoB)
Enzymes [BR:lsn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LSA_01210 (atoB)
Exosome [BR:lsn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LSA_01210 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(119000..120235)
Genome map
AA seq 411 aa AA seqDB search
MTHKTGIIELNHIRRSLQELKKIAIVSAKRTPIGKINGQLSSLNSVDLGVIAAKSTMNSI
NLDPKLVDQVIFGNVIQAGGGQNIARQIELKSGIPDTSTACTINQVCGSGMKAIRLGQQA
ILTNDADIVLVGGTESMSNAPYLNSKVRQGRKFGAFTMEDSIEKDGLNDFRTNAPMGITA
ENVAEKFNISRAAQDQFALSSHQKAAKAIKNNYFAAEMTPITIRGKKTATVISTDETVRP
DTTIEQLAKLRTSFKENGTVTAGNAASLNDGASALIMMTEDRAKELNLKPLAIIDNYAEA
GCNPDIMGYAPRYAVEKLLKKEQKNISDYDLFELNEAFASQSLAVVNDLHIPMEKLNITG
GAVALGHPLGDSGARILITLINNLKRTNQKSGIATLCIGGGMGMAMSIHIN
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atcactcataagacaggtataatagaattaaatcacatacgaaggagtcttcaagaattg
aaaaaaattgcaatcgtgagtgctaaacgaaccccaattggaaaaatcaacggacaacta
agtagtctaaactcagttgaccttggagtaatcgctgctaaatcaacaatgaactccatt
aatttagatccaaaactagtagatcaagtaatctttggaaatgtaattcaagctggcggt
ggtcaaaatattgctcgtcaaattgaactaaagtctggaattcctgataccagtactgct
tgtacaatcaaccaggtttgtggttctgggatgaaagcaatccggcttgggcagcaagca
atcttaaccaatgatgctgatattgttttagttggtggaaccgaaagtatgtcaaatgct
ccttatttaaattctaaggttcgtcaaggtcgcaaatttggtgcatttactatggaggat
agtattgaaaaagatggattaaatgacttccgcacaaacgctcccatgggaattacggcc
gaaaatgtagctgaaaaatttaacatatctcgtgcagctcaagatcaatttgctctttca
tctcaccaaaaagctgctaaagcaattaaaaataactattttgcagcagaaatgaccccg
ataacaattcgtggcaaaaaaacagcaacggtaatttcaactgatgaaaccgttcgtcct
gacactactattgaacaattagcaaagcttagaacatcatttaaggaaaacggaaccgta
actgctggaaacgcggctagtctaaatgatggtgcatcggcattaatcatgatgacagaa
gatcgtgctaaagaacttaatttaaagcctttagcaatcatcgataattatgcagaagca
ggatgtaaccccgatatcatgggatatgctcctcgttatgccgttgaaaagttattgaaa
aaggaacaaaaaaacatctctgattatgatttatttgaattgaacgaggcctttgcttct
caaagtttagcggttgtcaatgaccttcatattccaatggaaaaattaaatatcaccggt
ggtgccgtcgctttgggtcatccgcttggggattcaggagctagaattctaattaccctc
atcaacaatttaaaaagaactaaccaaaaatctggaattgcaaccctttgtatcggtggt
ggtatgggaatggcaatgagcattcacattaattaa

DBGET integrated database retrieval system