KEGG   Lactobacillus sanfranciscensis: LSA_02080Help
Entry
LSA_02080         CDS       T01627                                 

Gene name
adh2
Definition
aldehyde-alcohol dehydrogenase 2 (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lsn  Lactobacillus sanfranciscensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lsn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LSA_02080 (adh2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSA_02080 (adh2)
   00620 Pyruvate metabolism
    LSA_02080 (adh2)
   00650 Butanoate metabolism
    LSA_02080 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    LSA_02080 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LSA_02080 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LSA_02080 (adh2)
   00626 Naphthalene degradation
    LSA_02080 (adh2)
Enzymes [BR:lsn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LSA_02080 (adh2)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LSA_02080 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
207526..210162
Genome map
AA seq 878 aa AA seqDB search
MNRRVNNMVEKKQPNVEAIKKNIDDMVAKAHVALDEMSNFDQKKVDHITHAMVIAGVSAH
QMLGEMAFKETGRGVAEDKAIKNLFATEEIWNNIRNDKTVGVIEENSEEDLIKVAEPLGV
LAGITPVTNPTSTTLFKSIISMKTRNAIIFSFHPQAIKSSIKAAQIMRDAAIAAGAPKDA
IQWITEPSREATNDLIQNPGVACTLATGGPGLVKAAYSTGKPALGVGPGNGPIYIEETAN
ISRAVNDLVLSKTFDNGMICATENSAVIDASIYDDVKEQLSLNRVYFIPDNEKQKLTDAM
FDSTRLSVKGPIAGATAQQIADMAGIKVPKDTQVLAVEMTGIGPKYPMSGEKLSPVISVY
KSKNHEDAFKIVAKLLNYGGLGHTAAIQTRNDQLAVDFGVAVKASRVLVNSPAGLGGVGN
LYNNMTPSLTLGTGSWGNNSISHNVTDYDLLNIKTIAKRRNNMQWIKLPKIYFEKNSVRY
LKDMPNIKKAFIVTSPSMVKYHYVDKVLDELNARPDGVQYYIFDDIHDEPTTDIVQAGVT
QMRGFKPDTIIALGGGSPLDAAKMMWLIYENPETDFFGAKQKFLDIRKRAYRFEKPSKSQ
MVAIPSTSGTGSEVTPFSVITDSKLHIKYPLADYALTPDVAIIDPQFVATVPKKTIAASG
LDALTHAIESYVSVMASDYTRPLSLQAIKMIFENLTDSYNGNMEARDKMHTASTIAGMAF
ANAFLGITHSIAHKLGGQFGITHGIAIAITLPHVIRYNFEKPKKIATWPKYESFRADQDY
AEIARYLGLPGSTNEELKEALVHKFIELAHSVGVTLSLKAQGVNKADLEAAATHLAELAY
ADQCTTANPKEPLFADLKKMILEDYDGVGVETETDKEV
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggagagtgaataatatggtagaaaagaaacaaccaaatgttgaagcaatcaaa
aagaatattgatgatatggttgccaaagcacatgttgccttagacgaaatgagtaatttt
gatcaaaagaaagttgatcacattacccacgcaatggtaattgccggggtaagcgctcac
caaatgcttggtgaaatggcctttaaagaaactggtcgtggagtcgctgaagataaagca
attaaaaacttatttgccactgaagaaatctggaataacatccggaacgataaaacagtt
ggtgtaattgaagaaaactcagaagaagatttaatcaaagtcgctgaaccacttggtgtg
ttagcaggaattactcctgtaactaacccaacttcaactactttattcaaatcaattatt
tcaatgaaaactagaaatgcaattatctttagttttcatccacaagctataaaatcatca
atcaaagctgctcaaattatgcgtgatgctgcgattgctgctggtgctcctaaagatgct
atccaatggattaccgaaccaagtcgtgaggcaactaatgatttgattcaaaacccaggg
gttgcatgtactttagcaactggtggtcctggtcttgttaaagctgcttactcaactggt
aaaccagctttaggtgttggtcctggtaatggtcctatttatattgaagaaacagctaac
atttctcgtgccgttaatgatttagttttatcaaaaacttttgataacggaatgatttgt
gcaactgaaaacagtgctgtgattgatgcttcaatctacgacgatgtaaaagaacaactt
tcacttaaccgggtttactttattcctgataatgaaaaacaaaaattaactgatgcaatg
tttgacagtactcgtttgagtgttaaaggcccaatcgctggagcaactgctcaacaaatt
gctgatatggccggaattaaggttccaaaggatactcaagttcttgctgttgaaatgact
ggaattggtcctaaatacccaatgtctggtgaaaaactttctcctgtaatttcagtttac
aagtcaaaaaatcatgaagatgcctttaaaattgtagctaaattattgaactacggtgga
ttaggtcatactgctgctattcaaactagaaatgatcaattagctgttgactttggtgtt
gctgtaaaagcttcacgggtcttggttaactcaccagctggtttaggtggtgttggtaac
ctttacaacaacatgactccttcattaacgttaggtactggatcatggggtaataactca
atctcacataacgttactgactacgacttattgaacattaagacaatcgcaaagagaaga
aataatatgcaatggattaaattacctaagatttacttcgaaaagaattcagttcgttac
cttaaagatatgccaaacatcaagaaggccttcatcgttaccagtccttcaatggttaaa
tatcactacgttgacaaagttttagatgaattaaatgcacgtccagatggcgttcaatac
tacatctttgatgatatccacgacgaaccaacaactgatatagttcaagcaggggttact
caaatgcgtggcttcaagccagataccattatcgctttaggtggtggttcaccacttgat
gctgctaagatgatgtggttaatttacgaaaacccagaaactgacttctttggagcaaaa
caaaaattcttagatatcagaaaacgtgcttaccgctttgaaaaaccaagcaagtcacaa
atggttgcgatcccaagtacttcaggtactggatcagaagtaacaccattctcagttatc
actgattctaaattacacatcaagtacccattagctgattacgctttgacccctgatgtt
gcgattattgatcctcaatttgtggctacggttccaaagaaaaccattgctgcttcagga
cttgatgctttaactcatgccattgaatcatacgtatcagtaatggcatctgactacact
cgtcccttatcactccaagccatcaagatgatttttgaaaacttgactgattcttacaat
ggcaacatggaagctcgtgacaagatgcacactgcttcaaccattgccggtatggccttt
gcaaacgccttcttgggaattacacactcaattgctcacaaacttggtggacaatttgga
attactcacggtatcgcaattgcaattaccttgccacatgtaattcgttacaactttgaa
aaacctaagaagattgctacttggcctaagtacgaatcattccgtgccgaccaagactac
gctgaaattgctcgttaccttggcttgccaggatcaactaacgaagaactcaaagaagct
ttggttcacaagttcatcgaattagctcactcagttggtgtaactttaagcttgaaggct
caaggagttaacaaagcagacctagaagctgctgcaactcatcttgctgaattagcttac
gctgaccaatgtactactgctaaccctaaagaaccacttttcgcagaccttaagaagatg
attcttgaagattacgatggagttggggttgaaactgaaacagataaagaagtttaa

DBGET integrated database retrieval system