KEGG   Lactobacillus sanfranciscensis: LSA_02080Help
Entry
LSA_02080         CDS       T01627                                 

Gene name
adh2
Definition
(GenBank) Aldehyde-alcohol dehydrogenase 2
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lsn  Lactobacillus sanfranciscensis
Pathway
lsn00010  Glycolysis / Gluconeogenesis
lsn00071  Fatty acid degradation
lsn00620  Pyruvate metabolism
lsn00625  Chloroalkane and chloroalkene degradation
lsn00626  Naphthalene degradation
lsn00650  Butanoate metabolism
lsn01100  Metabolic pathways
lsn01110  Biosynthesis of secondary metabolites
lsn01120  Microbial metabolism in diverse environments
lsn01130  Biosynthesis of antibiotics
lsn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lsn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSA_02080 (adh2)
   00620 Pyruvate metabolism
    LSA_02080 (adh2)
   00650 Butanoate metabolism
    LSA_02080 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    LSA_02080 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LSA_02080 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LSA_02080 (adh2)
   00626 Naphthalene degradation
    LSA_02080 (adh2)
Enzymes [BR:lsn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LSA_02080 (adh2)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LSA_02080 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 DUF948
Motif
Other DBs
NCBI-ProteinID: AEN98674
UniProt: G2KV76
Position
207526..210162
Genome map
AA seq 878 aa AA seqDB search
MNRRVNNMVEKKQPNVEAIKKNIDDMVAKAHVALDEMSNFDQKKVDHITHAMVIAGVSAH
QMLGEMAFKETGRGVAEDKAIKNLFATEEIWNNIRNDKTVGVIEENSEEDLIKVAEPLGV
LAGITPVTNPTSTTLFKSIISMKTRNAIIFSFHPQAIKSSIKAAQIMRDAAIAAGAPKDA
IQWITEPSREATNDLIQNPGVACTLATGGPGLVKAAYSTGKPALGVGPGNGPIYIEETAN
ISRAVNDLVLSKTFDNGMICATENSAVIDASIYDDVKEQLSLNRVYFIPDNEKQKLTDAM
FDSTRLSVKGPIAGATAQQIADMAGIKVPKDTQVLAVEMTGIGPKYPMSGEKLSPVISVY
KSKNHEDAFKIVAKLLNYGGLGHTAAIQTRNDQLAVDFGVAVKASRVLVNSPAGLGGVGN
LYNNMTPSLTLGTGSWGNNSISHNVTDYDLLNIKTIAKRRNNMQWIKLPKIYFEKNSVRY
LKDMPNIKKAFIVTSPSMVKYHYVDKVLDELNARPDGVQYYIFDDIHDEPTTDIVQAGVT
QMRGFKPDTIIALGGGSPLDAAKMMWLIYENPETDFFGAKQKFLDIRKRAYRFEKPSKSQ
MVAIPSTSGTGSEVTPFSVITDSKLHIKYPLADYALTPDVAIIDPQFVATVPKKTIAASG
LDALTHAIESYVSVMASDYTRPLSLQAIKMIFENLTDSYNGNMEARDKMHTASTIAGMAF
ANAFLGITHSIAHKLGGQFGITHGIAIAITLPHVIRYNFEKPKKIATWPKYESFRADQDY
AEIARYLGLPGSTNEELKEALVHKFIELAHSVGVTLSLKAQGVNKADLEAAATHLAELAY
ADQCTTANPKEPLFADLKKMILEDYDGVGVETETDKEV
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggagagtgaataatatggtagaaaagaaacaaccaaatgttgaagcaatcaaa
aagaatattgatgatatggttgccaaagcacatgttgccttagacgaaatgagtaatttt
gatcaaaagaaagttgatcacattacccacgcaatggtaattgccggggtaagcgctcac
caaatgcttggtgaaatggcctttaaagaaactggtcgtggagtcgctgaagataaagca
attaaaaacttatttgccactgaagaaatctggaataacatccggaacgataaaacagtt
ggtgtaattgaagaaaactcagaagaagatttaatcaaagtcgctgaaccacttggtgtg
ttagcaggaattactcctgtaactaacccaacttcaactactttattcaaatcaattatt
tcaatgaaaactagaaatgcaattatctttagttttcatccacaagctataaaatcatca
atcaaagctgctcaaattatgcgtgatgctgcgattgctgctggtgctcctaaagatgct
atccaatggattaccgaaccaagtcgtgaggcaactaatgatttgattcaaaacccaggg
gttgcatgtactttagcaactggtggtcctggtcttgttaaagctgcttactcaactggt
aaaccagctttaggtgttggtcctggtaatggtcctatttatattgaagaaacagctaac
atttctcgtgccgttaatgatttagttttatcaaaaacttttgataacggaatgatttgt
gcaactgaaaacagtgctgtgattgatgcttcaatctacgacgatgtaaaagaacaactt
tcacttaaccgggtttactttattcctgataatgaaaaacaaaaattaactgatgcaatg
tttgacagtactcgtttgagtgttaaaggcccaatcgctggagcaactgctcaacaaatt
gctgatatggccggaattaaggttccaaaggatactcaagttcttgctgttgaaatgact
ggaattggtcctaaatacccaatgtctggtgaaaaactttctcctgtaatttcagtttac
aagtcaaaaaatcatgaagatgcctttaaaattgtagctaaattattgaactacggtgga
ttaggtcatactgctgctattcaaactagaaatgatcaattagctgttgactttggtgtt
gctgtaaaagcttcacgggtcttggttaactcaccagctggtttaggtggtgttggtaac
ctttacaacaacatgactccttcattaacgttaggtactggatcatggggtaataactca
atctcacataacgttactgactacgacttattgaacattaagacaatcgcaaagagaaga
aataatatgcaatggattaaattacctaagatttacttcgaaaagaattcagttcgttac
cttaaagatatgccaaacatcaagaaggccttcatcgttaccagtccttcaatggttaaa
tatcactacgttgacaaagttttagatgaattaaatgcacgtccagatggcgttcaatac
tacatctttgatgatatccacgacgaaccaacaactgatatagttcaagcaggggttact
caaatgcgtggcttcaagccagataccattatcgctttaggtggtggttcaccacttgat
gctgctaagatgatgtggttaatttacgaaaacccagaaactgacttctttggagcaaaa
caaaaattcttagatatcagaaaacgtgcttaccgctttgaaaaaccaagcaagtcacaa
atggttgcgatcccaagtacttcaggtactggatcagaagtaacaccattctcagttatc
actgattctaaattacacatcaagtacccattagctgattacgctttgacccctgatgtt
gcgattattgatcctcaatttgtggctacggttccaaagaaaaccattgctgcttcagga
cttgatgctttaactcatgccattgaatcatacgtatcagtaatggcatctgactacact
cgtcccttatcactccaagccatcaagatgatttttgaaaacttgactgattcttacaat
ggcaacatggaagctcgtgacaagatgcacactgcttcaaccattgccggtatggccttt
gcaaacgccttcttgggaattacacactcaattgctcacaaacttggtggacaatttgga
attactcacggtatcgcaattgcaattaccttgccacatgtaattcgttacaactttgaa
aaacctaagaagattgctacttggcctaagtacgaatcattccgtgccgaccaagactac
gctgaaattgctcgttaccttggcttgccaggatcaactaacgaagaactcaaagaagct
ttggttcacaagttcatcgaattagctcactcagttggtgtaactttaagcttgaaggct
caaggagttaacaaagcagacctagaagctgctgcaactcatcttgctgaattagcttac
gctgaccaatgtactactgctaaccctaaagaaccacttttcgcagaccttaagaagatg
attcttgaagattacgatggagttggggttgaaactgaaacagataaagaagtttaa

DBGET integrated database retrieval system