KEGG   Lactobacillus sanfranciscensis: LSA_02720Help
Entry
LSA_02720         CDS       T01627                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lsn  Lactobacillus sanfranciscensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lsn00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
263759..265273
Genome map
AA seq 504 aa AA seqDB search
MEDDETKYVLAIDQGSTSTRAVFYDHSGRKVIESTKPLSQKNDKNGWVEQDPDLIWSSVL
SAISSAMIDARIHPEKIRAIGITNQRETTVVWNKNTGKPIYNAIGWLSKQTTGIAKQLRE
EGYSDLIREKTGLVLNAYFSATKVRWILDHVEGAQERAEKGELLFGTIDSWLVWKLSDGR
YHITDYSNASRTMLYNIHELKWDQDILDILHIPVQMLPEVHASDEVYGTTENYQFYGVQV
PIAGIAGDQQAALIGSMGLEPGMVESTYGDGAFIMMNTGTKPEISDEKLLTTIAYGMNGK
VYYALEGSIFTAGSALKWLRDKLGLISSIPGSRIAAKRSNNDNEVYLVPAFTGLGAPYWD
SSVRGAIFGITRGTNDDDIVKATLQSIAYSTKDIIDTMEADANIKISQLGADGGASRNSY
LMQFQADILDKPVERAADEETTAFGAAVLAGLATGFWKDIDEVKSIHEPGKLFTPEISSQ
EREKLYHGWKRAVKAAQTFKPEIN
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtggaagatgacgaaactaagtatgtactagcaattgaccaaggatcaacaagtactaga
gccgttttttatgaccatagtggtcgcaaggtaattgaaagtacgaaaccattgtcccaa
aaaaatgacaaaaatggatgggtagaacaagatcctgatttaatttggagttctgtttta
tcagcaatttctagtgccatgattgacgcccgaattcatcctgaaaagattagagcaatt
ggaattactaaccaacgagaaacaaccgttgtatggaacaaaaacaccggtaaaccaatt
tataatgcgattggatggctttcaaaacaaactactggaattgctaaacaacttcgtgag
gaaggctacagtgatttaattcgggaaaaaacgggattggtgttgaatgcatacttttca
gccaccaaagttcgttggattttagatcacgttgaaggagcccaagaacgggctgaaaaa
ggtgaattactgtttggaacgattgacagttggctggtatggaagttatcagatggaaga
tatcatattactgattacagtaatgccagtcggacaatgctttataacattcacgaattg
aaatgggatcaagatattttagatattttgcatattccagtgcaaatgttacctgaggtc
catgcttctgatgaggtttatggaacaaccgagaattaccaattttatggagttcaagtg
ccaattgcaggaattgctggggatcaacaagcagcattgattggatcaatggggcttgaa
ccagggatggtagaaagtacctatggtgatggtgcttttatcatgatgaacactggtact
aaaccagaaatttcagatgaaaaattattaacaacgattgcctatggaatgaatggaaaa
gtttattacgcattagaaggatctatttttacggctggaagtgcattgaagtggcttcgt
gacaaattaggattgattagtagtattcctggttcacgaattgcggcaaaacgttcaaat
aatgataatgaagtctatttggtacctgcttttacaggattaggtgctccatactgggat
tcaagcgtccggggtgcaatctttggaattactcgcggaacaaatgatgatgatatcgtt
aaggcaaccctccagtcgattgcatatagtaccaaagatattattgatacgatggaagca
gatgccaacattaaaatttcacaacttggagctgatggtggggctagtcggaatagttat
ttgatgcaatttcaagctgatatcttagataaaccagttgaaagagcggcggatgaagaa
acgacggcctttggagcagctgttttggctggcttggcaactggattctggaaagatatt
gatgaagtaaaatcgattcatgaacctggtaagctgttcacccccgaaattagttctcaa
gaaagagaaaaactttatcatggttggaaacgagcagtcaaggcagcccagacttttaaa
ccagaaataaattaa

DBGET integrated database retrieval system