KEGG   Lactobacillus sanfranciscensis: LSA_03170Help
Entry
LSA_03170         CDS       T01627                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lsn  Lactobacillus sanfranciscensis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:lsn00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
303250..303834
Genome map
AA seq 194 aa AA seqDB search
MKGGIKMRENQRVIVLTGAAGTGKTTVQNYLKQAYQIPSIITHTTRSARTGEQSGVDYYF
ENKASFDQLHLLESVQYADNRYGSSWEGINKALQEHQFASIVLDTAGAITYQKQLGEKAK
IIFLAVDNQCEIKTRMLKRGDRLADVEKRMQSKEVNRDLNLPSELQGHATIIENENWQKT
KQSIDQIIKKLSND
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggggaattaaaatgcgagaaaatcaacgggtaattgtgttgactggggctgcc
ggaaccggcaaaaccacggttcagaattatttgaaacaagcttatcaaattccatcaatt
attacgcatactactcgctcagctcgtaccggtgaacaaagtggagttgattattacttt
gaaaataaggctagttttgaccaacttcacttgttagaatctgttcaatacgctgacaat
cgttatggttcttcttgggaaggaattaataaagcccttcaagaacatcaatttgccagt
attgttttagatactgccggggcgattacttaccaaaaacagttaggtgaaaaagctaaa
attatctttttggcagttgataatcaatgtgaaatcaaaaccagaatgcttaagcgcggt
gatcggttagctgatgtagaaaaaagaatgcaaagtaaagaagttaatcgtgatttgaat
ttaccaagtgaattacaaggacatgcgacaatcattgaaaatgaaaattggcaaaaaaca
aaacaatcgattgatcaaattatcaaaaaattaagtaatgattaa

DBGET integrated database retrieval system