KEGG   Lactobacillus sanfranciscensis: LSA_03170Help
Entry
LSA_03170         CDS       T01627                                 

Definition
(GenBank) hypothetical protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lsn  Lactobacillus sanfranciscensis
Pathway
lsn00230  Purine metabolism
lsn01100  Metabolic pathways
Module
lsn_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lsn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LSA_03170
Enzymes [BR:lsn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LSA_03170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_22 AAA_30 AAA_28 CoaE Thymidylate_kin MMR_HSR1 SRP54 AAA_16 AAA_24 ABC_tran AAA_25 AAA_17 AAA_19 TrwB_AAD_bind AAA_14 T2SSE RsgA_GTPase TsaE CPT AAA_33 AAA_5 ATPase
Motif
Other DBs
NCBI-ProteinID: AEN98772
UniProt: G2KTF6
Position
303250..303834
Genome map
AA seq 194 aa AA seqDB search
MKGGIKMRENQRVIVLTGAAGTGKTTVQNYLKQAYQIPSIITHTTRSARTGEQSGVDYYF
ENKASFDQLHLLESVQYADNRYGSSWEGINKALQEHQFASIVLDTAGAITYQKQLGEKAK
IIFLAVDNQCEIKTRMLKRGDRLADVEKRMQSKEVNRDLNLPSELQGHATIIENENWQKT
KQSIDQIIKKLSND
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggggaattaaaatgcgagaaaatcaacgggtaattgtgttgactggggctgcc
ggaaccggcaaaaccacggttcagaattatttgaaacaagcttatcaaattccatcaatt
attacgcatactactcgctcagctcgtaccggtgaacaaagtggagttgattattacttt
gaaaataaggctagttttgaccaacttcacttgttagaatctgttcaatacgctgacaat
cgttatggttcttcttgggaaggaattaataaagcccttcaagaacatcaatttgccagt
attgttttagatactgccggggcgattacttaccaaaaacagttaggtgaaaaagctaaa
attatctttttggcagttgataatcaatgtgaaatcaaaaccagaatgcttaagcgcggt
gatcggttagctgatgtagaaaaaagaatgcaaagtaaagaagttaatcgtgatttgaat
ttaccaagtgaattacaaggacatgcgacaatcattgaaaatgaaaattggcaaaaaaca
aaacaatcgattgatcaaattatcaaaaaattaagtaatgattaa

DBGET integrated database retrieval system