KEGG   Lactobacillus sanfranciscensis: LSA_03840Help
Entry
LSA_03840         CDS       T01627                                 

Gene name
gpmA2
Definition
2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lsn  Lactobacillus sanfranciscensis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lsn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LSA_03840 (gpmA2)
   01230 Biosynthesis of amino acids
    LSA_03840 (gpmA2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSA_03840 (gpmA2)
  Energy metabolism
   00680 Methane metabolism
    LSA_03840 (gpmA2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LSA_03840 (gpmA2)
Enzymes [BR:lsn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LSA_03840 (gpmA2)
Exosome [BR:lsn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LSA_03840 (gpmA2)
  Exosomal proteins of melanoma cells
   LSA_03840 (gpmA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
357064..357762
Genome map
AA seq 232 aa AA seqDB search
MAKLCLIRHGQSEWNLANKFTGWVDVDLSEEGVKQAKHAGKLIADAGLEFDQAYTSVLKR
AINTLHYALGESNQLWIPEMKSWRLNERHYGALQGHNKERAAEKYGADQVHIWRRSYDVL
PPLLSADDEGSATKDRRYADLDPRAIPAGENLKTTLERVIPFWQDEIAPKLLDHKNVIIA
AHGNSLRALTKYIEGISDEDIMDVEIATGDPIVYDIDENLNIVSKTKLDENR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattatgtttaattcgtcacggacaaagtgaatggaacttagcaaacaaattc
actggatgggttgatgttgatctaagtgaagaaggagttaagcaagctaaacatgcaggt
aagttaattgccgatgccggtcttgaatttgaccaagcttacacttcagttttaaaacgt
gccattaacacattgcactatgctttaggtgaaagtaaccaattatggattccagaaatg
aaatcatggcgtttaaacgaacgtcattacggtgctttacaaggtcacaacaaagaacgt
gctgctgaaaagtacggtgcagaccaagttcacatttggcgtcgttcatatgatgttttg
cctccactattgagtgccgatgatgaaggttcagcaactaaagaccgtcgttacgctgat
ttagacccacgtgcaattcctgcaggtgaaaatcttaaaaccactttggaacgtgtaatt
ccattctggcaagatgaaattgctcctaaattattagatcacaagaacgtaatcattgct
gcacatggtaactcattacgtgccttaactaaatacatcgaaggtatttctgatgaagat
atcatggatgtagaaattgctactggtgatccaattgtttacgacattgacgaaaactta
aacatcgtaagtaaaactaagttagacgaaaacagataa

DBGET integrated database retrieval system