KEGG   Lactobacillus sanfranciscensis: LSA_04500Help
Entry
LSA_04500         CDS       T01627                                 

Gene name
gltX2
Definition
glutamyl-tRNA synthetase 2 (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lsn  Lactobacillus sanfranciscensis
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:lsn00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
444971..446461
Genome map
AA seq 496 aa AA seqDB search
MANNKIRVRYAPSPTGHLHIGNARTAIFNYLFARHYKGKFIIRIEDTDTKRNVADGEKSQ
LDNLKWLGLDWDEGPDVGGDFGPYRQSERRATYDPLIQKLLDEDKAYYSYKTEEELEAER
EEQKARGVMPHYEYEFAGMTEDERKAAIADAEAKGLKPVIRFRVPKNHTYEWDDLVKGHV
SFNSDSIGGDFVIVKRDGMPTYNFAVVADDHNMQISHVFRGDDHVANTPKQLMIYEAFGW
QAPKFGHMSLIISADTGKKLSKRDETVLQFIEQYHELGYLPDALFNFIVLLGWSPVGEDE
IFNQRQFIKMYDESRLSKSPATFDSKKLEWINNQYVKNSDEDTIVDLALRQLIKGGKLPE
NPDALTIEWARKLIDVYRPQMSYMAQINEMANVFFEDPELIKGDALEEIENETAPVVLKA
FAEKIKELPIFDKVEILKTIKSIQKETKIKGRQLWMPIRIAVTHEMEGPELPESIELIGR
EKTLKHLQQTLDQISK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaataataaaattcgtgttcgttatgcaccaagtccaactggacatttgcatatt
gggaacgcaagaactgcaatttttaactatctttttgcccgtcattacaagggtaaattc
atcattcgaattgaagatacagatacaaaacgtaatgtcgctgatggtgaaaagagtcaa
ttggacaaccttaaatggttaggacttgactgggatgaaggtcctgatgttgggggagat
tttggtccttatcgtcaatcagaacgtcgcgctacctatgatcctttgattcaaaaactt
ttagacgaagataaagcttactattcatacaaaactgaagaagaacttgaagccgaacgt
gaagaacaaaaggctcgtggggtaatgcctcactatgaatacgaatttgccggcatgact
gaagacgaacgcaaagctgcgattgcagatgctgaagctaaagggttaaaaccagttatt
cgtttccgagttcctaagaatcatacttacgaatgggacgacctcgttaaaggtcatgtt
tcctttaattcagatagtattggtggagatttcgtcattgttaaacgtgacggaatgcct
acttataactttgccgtagttgcggatgaccataacatgcaaattagtcatgttttccgt
ggtgatgatcacgttgccaatacccctaagcaattaatgatttatgaagcttttggttgg
caagcacctaagtttggtcacatgagcttaattattagtgccgataccggtaagaaatta
agtaaacgtgatgaaacagtgcttcaatttatcgaacaatatcatgaattaggttactta
ccagacgctttgtttaacttcattgtgttattgggttggtcaccagtgggtgaagatgaa
atctttaaccaacgtcaattcattaaaatgtatgatgaatcacgtttgagtaaatcacca
gctacttttgatagtaagaagctagaatggattaataaccaatacgttaagaattctgac
gaagacaccattgttgatttggcattacgtcaattaattaaaggtggcaagttaccagaa
aatccagatgctttaaccattgaatgggctcgtaaattgattgatgtttaccgtccacaa
atgagttacatggctcaaattaatgaaatggctaatgttttctttgaagatcctgagttg
attaaaggggatgcactcgaagaaattgaaaacgaaacagctcctgttgttttaaaagcc
tttgccgaaaaaatcaaagaactaccaatttttgataaagttgaaattttgaaaaccatt
aagtcaattcaaaaagaaactaagattaagggtcgtcaattatggatgccaattcgaatt
gctgtaactcatgaaatggaaggccctgaactacctgaatcaattgaattgattggtcgc
gaaaagactttgaagcatttacaacaaacacttgatcaaattagcaaataa

DBGET integrated database retrieval system