KEGG   Lactobacillus sanfranciscensis: LSA_04500Help
Entry
LSA_04500         CDS       T01627                                 

Gene name
gltX2
Definition
glutamyl-tRNA synthetase 2 (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lsn  Lactobacillus sanfranciscensis
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:lsn00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    LSA_04500 (gltX2)
Enzymes [BR:lsn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     LSA_04500 (gltX2)
Amino acid related enzymes [BR:lsn01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   LSA_04500 (gltX2)
Transfer RNA biogenesis [BR:lsn03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    LSA_04500 (gltX2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
444971..446461
Genome map
AA seq 496 aa AA seqDB search
MANNKIRVRYAPSPTGHLHIGNARTAIFNYLFARHYKGKFIIRIEDTDTKRNVADGEKSQ
LDNLKWLGLDWDEGPDVGGDFGPYRQSERRATYDPLIQKLLDEDKAYYSYKTEEELEAER
EEQKARGVMPHYEYEFAGMTEDERKAAIADAEAKGLKPVIRFRVPKNHTYEWDDLVKGHV
SFNSDSIGGDFVIVKRDGMPTYNFAVVADDHNMQISHVFRGDDHVANTPKQLMIYEAFGW
QAPKFGHMSLIISADTGKKLSKRDETVLQFIEQYHELGYLPDALFNFIVLLGWSPVGEDE
IFNQRQFIKMYDESRLSKSPATFDSKKLEWINNQYVKNSDEDTIVDLALRQLIKGGKLPE
NPDALTIEWARKLIDVYRPQMSYMAQINEMANVFFEDPELIKGDALEEIENETAPVVLKA
FAEKIKELPIFDKVEILKTIKSIQKETKIKGRQLWMPIRIAVTHEMEGPELPESIELIGR
EKTLKHLQQTLDQISK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaataataaaattcgtgttcgttatgcaccaagtccaactggacatttgcatatt
gggaacgcaagaactgcaatttttaactatctttttgcccgtcattacaagggtaaattc
atcattcgaattgaagatacagatacaaaacgtaatgtcgctgatggtgaaaagagtcaa
ttggacaaccttaaatggttaggacttgactgggatgaaggtcctgatgttgggggagat
tttggtccttatcgtcaatcagaacgtcgcgctacctatgatcctttgattcaaaaactt
ttagacgaagataaagcttactattcatacaaaactgaagaagaacttgaagccgaacgt
gaagaacaaaaggctcgtggggtaatgcctcactatgaatacgaatttgccggcatgact
gaagacgaacgcaaagctgcgattgcagatgctgaagctaaagggttaaaaccagttatt
cgtttccgagttcctaagaatcatacttacgaatgggacgacctcgttaaaggtcatgtt
tcctttaattcagatagtattggtggagatttcgtcattgttaaacgtgacggaatgcct
acttataactttgccgtagttgcggatgaccataacatgcaaattagtcatgttttccgt
ggtgatgatcacgttgccaatacccctaagcaattaatgatttatgaagcttttggttgg
caagcacctaagtttggtcacatgagcttaattattagtgccgataccggtaagaaatta
agtaaacgtgatgaaacagtgcttcaatttatcgaacaatatcatgaattaggttactta
ccagacgctttgtttaacttcattgtgttattgggttggtcaccagtgggtgaagatgaa
atctttaaccaacgtcaattcattaaaatgtatgatgaatcacgtttgagtaaatcacca
gctacttttgatagtaagaagctagaatggattaataaccaatacgttaagaattctgac
gaagacaccattgttgatttggcattacgtcaattaattaaaggtggcaagttaccagaa
aatccagatgctttaaccattgaatgggctcgtaaattgattgatgtttaccgtccacaa
atgagttacatggctcaaattaatgaaatggctaatgttttctttgaagatcctgagttg
attaaaggggatgcactcgaagaaattgaaaacgaaacagctcctgttgttttaaaagcc
tttgccgaaaaaatcaaagaactaccaatttttgataaagttgaaattttgaaaaccatt
aagtcaattcaaaaagaaactaagattaagggtcgtcaattatggatgccaattcgaatt
gctgtaactcatgaaatggaaggccctgaactacctgaatcaattgaattgattggtcgc
gaaaagactttgaagcatttacaacaaacacttgatcaaattagcaaataa

DBGET integrated database retrieval system