KEGG   Lactobacillus sanfranciscensis: LSA_06130Help
Entry
LSA_06130         CDS       T01627                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lsn  Lactobacillus sanfranciscensis
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:lsn03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
602095..602946
Genome map
AA seq 283 aa AA seqDB search
MAFMPELPEVQTVRQGLNKLVKGSKIKSVEVLYPKMINIPAEDFEKKLAGKEIIQIDRRG
KYLLFRLSDDLTLVSHLRMEGKYEVQSEGTERPKHTNVVFHLTDGRELRYKDTRMFGKMA
LVKNEDVYKLSGLNKIGPEPTEQDLKFDYMKEIMHKSHRKIKGFLLDQSKIAGLGNIYCD
EVLWLSKINPEQLTNELSDDEIRRLRANIIKEIAAAIKDHGTTVHSYSNAYGEAGQFQNQ
LHAYGRKDEKCECCGTTMEKIKVAQRGTTFCPKCQKLHGDLSD
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtggctttcatgccagaattaccagaggttcaaacggttcgtcaaggattaaataaatta
gttaaaggatcgaagattaaatctgtagaagttttataccctaagatgattaatattcca
gctgaagattttgaaaaaaaattagcaggaaaagaaatcattcaaattgaccgtcgaggc
aaatatcttttatttagattgagtgatgatttgacacttgtttcccatttgagaatggaa
ggaaagtatgaagttcaatctgaaggaactgaaagacctaagcatacaaatgtcgttttt
catttaactgatggtcgtgaattacgctataaagatactcgaatgtttggaaaaatggct
ttagttaaaaatgaagatgtttataaattatcagggttaaataaaattggccctgaacct
actgaacaagatttgaagtttgattacatgaaagaaatcatgcacaaatctcatcgtaaa
atcaaaggattcttattagatcaatcaaaaattgcgggattaggaaatatttattgtgat
gaagttctttggctatccaaaataaatccagaacaacttactaatgaattaagtgatgat
gagattagaagattacgagcaaatattattaaagaaattgctgcagcaatcaaggatcac
ggaaccactgttcactcatattcaaatgcatatggtgaagcaggccaattccaaaatcaa
cttcatgcttatgggcgtaaagatgaaaaatgtgagtgttgtggaactacaatggaaaaa
attaaagtggcacaaaggggaacgactttctgtcctaaatgtcaaaaactacatggtgat
ctaagtgactaa

DBGET integrated database retrieval system