KEGG   Lactobacillus sanfranciscensis: LSA_06460Help
Entry
LSA_06460         CDS       T01627                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lsn  Lactobacillus sanfranciscensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lsn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LSA_06460 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSA_06460 (glcK)
   00052 Galactose metabolism
    LSA_06460 (glcK)
   00500 Starch and sucrose metabolism
    LSA_06460 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    LSA_06460 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LSA_06460 (glcK)
   00524 Butirosin and neomycin biosynthesis
    LSA_06460 (glcK)
Enzymes [BR:lsn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LSA_06460 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
628954..629925
Genome map
AA seq 323 aa AA seqDB search
MVMSKGLIGIDLGGTTTKMAFLNEDGEVLEKWRILTDISDNGSHIVPNIIKSISKHIEDS
GKTTDDFIGIGMGTPGAVNRENGTVSEAFNLNWKTTQPIRKDIQAGLGLPFDLDNDANVA
SLGEYWKGAGSNEDDIVFATLGTGVGGGVIANGKLLHGVNGGAGEIGHITVQPNGYLCTC
GKRGCLETYASATGIVRVADDMAKEFNGTSRLKELIDDGDEKITSKLVFYLADNGDILAN
QVVDRICFYLGLALSMIGNTLNPASIIIGGGVSNAGNTLLQPTTKYFQQNAFPSVRDSTK
IKLAKLGNDAGVIGAASMALQFR
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atagttatgtcaaaaggtttaattggtattgatttaggtggtacaactacaaaaatggcc
tttctcaatgaagatggtgaagttttagaaaaatggagaattttgactgatattagtgat
aatggaagtcatatcgttcctaatattattaaatcaatttcaaaacatattgaagattca
ggtaaaacaactgatgattttattggaattggaatgggaactcctggtgctgttaatcgt
gaaaatggaactgtgtcagaagcttttaatttaaactggaaaactacccaaccaattcgt
aaagatattcaagcaggtctaggtttaccttttgatttagataacgatgcaaacgttgct
tcacttggtgaatattggaaaggtgctggtagtaacgaagatgatattgttttcgctact
cttggaactggtgttggtggtggagttattgccaacggtaaattgcttcatggagtaaac
ggtggagcaggtgaaataggtcatattactgttcaaccaaatggttatttatgtacttgt
ggtaaaaggggatgtctagaaacttatgcatctgcaactggaattgttagagtagctgat
gatatggctaaagaattcaatggaacatcacgtttgaaggaacttattgatgatggtgat
gaaaagattacctcaaaacttgtgttttatcttgcagataatggagatattttagctaat
caagtcgttgatcggatttgtttctatcttggattagctctttcaatgattggtaataca
ttaaacccagcaagtattattatcggtggtggagtttctaatgcgggtaatactctatta
caacctactactaaatacttccaacaaaatgcgtttccatcagttagagactcaactaag
attaaattagctaaacttggaaatgatgctggagtaattggtgctgcatcaatggcatta
cagtttagataa

DBGET integrated database retrieval system