KEGG   Lactobacillus sanfranciscensis: LSA_06460Help
Entry
LSA_06460         CDS       T01627                                 

Gene name
glcK
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lsn  Lactobacillus sanfranciscensis
Pathway
lsn00010  Glycolysis / Gluconeogenesis
lsn00052  Galactose metabolism
lsn00500  Starch and sucrose metabolism
lsn00520  Amino sugar and nucleotide sugar metabolism
lsn00521  Streptomycin biosynthesis
lsn01100  Metabolic pathways
lsn01110  Biosynthesis of secondary metabolites
lsn01120  Microbial metabolism in diverse environments
lsn01130  Biosynthesis of antibiotics
lsn01200  Carbon metabolism
Module
lsn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lsn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSA_06460 (glcK)
   00052 Galactose metabolism
    LSA_06460 (glcK)
   00500 Starch and sucrose metabolism
    LSA_06460 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    LSA_06460 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LSA_06460 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LSA_06460 (glcK)
Enzymes [BR:lsn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LSA_06460 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Hydant_A_N FGGY_N
Motif
Other DBs
NCBI-ProteinID: AEN99069
UniProt: G2KW93
Position
628954..629925
Genome map
AA seq 323 aa AA seqDB search
MVMSKGLIGIDLGGTTTKMAFLNEDGEVLEKWRILTDISDNGSHIVPNIIKSISKHIEDS
GKTTDDFIGIGMGTPGAVNRENGTVSEAFNLNWKTTQPIRKDIQAGLGLPFDLDNDANVA
SLGEYWKGAGSNEDDIVFATLGTGVGGGVIANGKLLHGVNGGAGEIGHITVQPNGYLCTC
GKRGCLETYASATGIVRVADDMAKEFNGTSRLKELIDDGDEKITSKLVFYLADNGDILAN
QVVDRICFYLGLALSMIGNTLNPASIIIGGGVSNAGNTLLQPTTKYFQQNAFPSVRDSTK
IKLAKLGNDAGVIGAASMALQFR
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atagttatgtcaaaaggtttaattggtattgatttaggtggtacaactacaaaaatggcc
tttctcaatgaagatggtgaagttttagaaaaatggagaattttgactgatattagtgat
aatggaagtcatatcgttcctaatattattaaatcaatttcaaaacatattgaagattca
ggtaaaacaactgatgattttattggaattggaatgggaactcctggtgctgttaatcgt
gaaaatggaactgtgtcagaagcttttaatttaaactggaaaactacccaaccaattcgt
aaagatattcaagcaggtctaggtttaccttttgatttagataacgatgcaaacgttgct
tcacttggtgaatattggaaaggtgctggtagtaacgaagatgatattgttttcgctact
cttggaactggtgttggtggtggagttattgccaacggtaaattgcttcatggagtaaac
ggtggagcaggtgaaataggtcatattactgttcaaccaaatggttatttatgtacttgt
ggtaaaaggggatgtctagaaacttatgcatctgcaactggaattgttagagtagctgat
gatatggctaaagaattcaatggaacatcacgtttgaaggaacttattgatgatggtgat
gaaaagattacctcaaaacttgtgttttatcttgcagataatggagatattttagctaat
caagtcgttgatcggatttgtttctatcttggattagctctttcaatgattggtaataca
ttaaacccagcaagtattattatcggtggtggagtttctaatgcgggtaatactctatta
caacctactactaaatacttccaacaaaatgcgtttccatcagttagagactcaactaag
attaaattagctaaacttggaaatgatgctggagtaattggtgctgcatcaatggcatta
cagtttagataa

DBGET integrated database retrieval system